StarFunc result for job id Q86Z14

User Input

>input (1044 residues)
MKPGCAAGSPGNEWIFFSTDEITTRYRNTMSNGGLQRSVILSALILLRAVTGFSGDGRAI
WSKNPNFTPVNESQLFLYDTFPKNFFWGIGTGALQVEGSWKKDGKGPSIWDHFIHTHLKN
VSSTNGSSDSYIFLEKDLSALDFIGVSFYQFSISWPRLFPDGIVTVANAKGLQYYSTLLD
ALVLRNIEPIVTLYHWDLPLALQEKYGGWKNDTIIDIFNDYATYCFQMFGDRVKYWITIH
NPYLVAWHGYGTGMHAPGEKGNLAAVYTVGHNLIKAHSKVWHNYNTHFRPHQKGWLSITL
GSHWIEPNRSENTMDIFKCQQSMVSVLGWFANPIHGDGDYPEGMRKKLFSVLPIFSEAEK
HEMRGTADFFAFSFGPNNFKPLNTMAKMGQNVSLNLREALNWIKLEYNNPRILIAENGWF
TDSRVKTEDTTAIYMMKNFLSQVLQAIRLDEIRVFGYTAWSLLDGFEWQDAYTIRRGLFY
VDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQGQFPCDFSWGVTESVLKPESVA
SSPQFSDPHLYVWNATGNRLLHRVEGVRLKTRPAQCTDFVNIKKQLEMLARMKVTHYRFA
LDWASVLPTGNLSAVNRQALRYYRCVVSEGLKLGISAMVTLYYPTHAHLGLPEPLLHADG
WLNPSTAEAFQAYAGLCFQELGDLVKLWITINEPNRLSDIYNRSGNDTYGAAHNLLVAHA
LAWRLYDRQFRPSQRGAVSLSLHADWAEPANPYADSHWRAAERFLQFEIAWFAEPLFKTG
DYPAAMREYIASKHRRGLSSSALPRLTEAERRLLKGTVDFCALNHFTTRFVMHEQLAGSR
YDSDRDIQFLQDITRLSSPTRLAVIPWGVRKLLRWVRRNYGDMDIYITASGIDDQALEDD
RLRKYYLGKYLQEVLKAYLIDKVRIKGYYAFKLAEEKSKPRFGFFTSDFKAKSSIQFYNK
VISSRGFPFENSSSRCSQTQENTECTVCLFLVQKKPLIFLGCCFFSTLVLLLSIAIFQRQ
KRRKFWKAKNLQHIPLKKGKRVVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5vanA	0.823	0.997	0.000	861	0.822	0.997	5vanA.pdb.gz	Structures of beta-klotho reveal a 'zip code'-like mechanism for endocrine FGF signalling.
2	AFDB:O35082	0.799	0.821	0.000	1014	0.443	0.457	O35082.pdb.gz	KLOT_MOUSE Klotho OS=Mus musculus OX=10090 GN=Kl PE=1 SV=2
3	AFDB:Q86Z14	1.000	1.000	0.000	1044	1.000	1.000	Q86Z14.pdb.gz	KLOTB_HUMAN Beta-klotho OS=Homo sapiens OX=9606 GN=KLB PE=1 SV=1
4	AFDB:Q99N32	0.915	0.916	0.000	1043	0.790	0.791	Q99N32.pdb.gz	KLOTB_MOUSE Beta-klotho OS=Mus musculus OX=10090 GN=Klb PE=1 SV=1
5	AFDB:Q9UEF7	0.780	0.803	0.000	1012	0.442	0.456	Q9UEF7.pdb.gz	KLOT_HUMAN Klotho OS=Homo sapiens OX=9606 GN=KL PE=1 SV=2
6	AFDB:P09849	0.750	0.420	1.283E-88	1926	0.346	0.187	P09849.pdb.gz	LPH_RABIT Lactase/phlorizin hydrolase OS=Oryctolagus cuniculus OX=9986 GN=LCT PE=1 SV=1
7	AFDB:P09848	0.746	0.418	3.507E-88	1927	0.355	0.193	P09848.pdb.gz	LPH_HUMAN Lactase/phlorizin hydrolase OS=Homo sapiens OX=9606 GN=LCT PE=1 SV=3
8	AFDB:Q02401	0.744	0.416	3.898E-88	1928	0.346	0.187	Q02401.pdb.gz	LPH_RAT Lactase/phlorizin hydrolase OS=Rattus norvegicus OX=10116 GN=Lct PE=1 SV=2
9	AFDB:Q9H227	0.389	0.853	8.604E-44	469	0.170	0.377	Q9H227.pdb.gz	GBA3_HUMAN Cytosolic beta-glucosidase OS=Homo sapiens OX=9606 GN=GBA3 PE=1 SV=2
10	PDB:2e9lA	0.387	0.853	2.328E-42	466	0.169	0.378	2e9lA.pdb.gz	Klotho-related protein is a novel cytosolic neutral beta-glycosylceramidase.
11	AFDB:Q8K1F9	0.401	0.727	7.323E-42	566	0.180	0.332	Q8K1F9.pdb.gz	LCTL_MOUSE Lactase-like protein OS=Mus musculus OX=10090 GN=Lctl PE=1 SV=1
12	AFDB:Q9FIW4	0.384	0.807	2.600E-39	490	0.157	0.335	Q9FIW4.pdb.gz	BGL42_ARATH Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=1 SV=1
13	PDB:7f3aA	0.382	0.820	4.725E-37	477	0.161	0.352	7f3aA.pdb.gz
14	PDB:3ahvA	0.374	0.815	2.708E-36	472	0.156	0.345	3ahvA.pdb.gz	The structural basis of oligosaccharide binding by rice BGlu1 beta-glucosidase
15	PDB:2e3zA	0.382	0.849	2.855E-36	460	0.151	0.343	2e3zA.pdb.gz
16	PDB:3u57A	0.378	0.824	7.017E-36	471	0.152	0.338	3u57A.pdb.gz	Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
17	PDB:2jf6B	0.380	0.827	1.288E-34	472	0.146	0.322	2jf6B.pdb.gz	Molecular Architecture of Strictosidine Glucosidase - the Gateway to the Biosynthesis of the Monoterpenoid Indole Alkaloid Family
18	PDB:3ahyB	0.382	0.839	1.285E-32	466	0.148	0.330	3ahyB.pdb.gz	Structural and functional analysis of three beta-glucosidases from bacterium Clostridium cellulovorans, fungus Trichoderma reesei and termite Neotermes koshunensis
19	PDB:1e1eB	0.376	0.780	1.428E-32	495	0.145	0.305	1e1eB.pdb.gz
20	PDB:2xhyA	0.363	0.775	6.049E-23	470	0.121	0.268	2xhyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35082	0.0	889	1014	0.442	0.455	KLOT_MOUSE Klotho OS=Mus musculus OX=10090 GN=Kl PE=1 SV=2
2	P09848	0.0	638	1927	0.358	0.194	LPH_HUMAN Lactase/phlorizin hydrolase OS=Homo sapiens OX=9606 GN=LCT PE=1 SV=3
3	P09849	0.0	583	1926	0.333	0.181	LPH_RABIT Lactase/phlorizin hydrolase OS=Oryctolagus cuniculus OX=9986 GN=LCT PE=1 SV=1
4	Q02401	0.0	596	1928	0.343	0.186	LPH_RAT Lactase/phlorizin hydrolase OS=Rattus norvegicus OX=10116 GN=Lct PE=1 SV=2
5	Q86Z14	0.0	2180	1044	1.000	1.000	KLOTB_HUMAN Beta-klotho OS=Homo sapiens OX=9606 GN=KLB PE=1 SV=1
6	Q99N32	0.0	1749	1043	0.789	0.790	KLOTB_MOUSE Beta-klotho OS=Mus musculus OX=10090 GN=Klb PE=1 SV=1
7	Q9UEF7	0.0	884	1012	0.441	0.455	KLOT_HUMAN Klotho OS=Homo sapiens OX=9606 GN=KL PE=1 SV=2
8	Q9Z2Y9	0.0	887	1014	0.443	0.456	KLOT_RAT Klotho OS=Rattus norvegicus OX=10116 GN=Kl PE=1 SV=1
9	W5PLZ6	0.0	590	1931	0.333	0.180	LPH_SHEEP Lactase/phlorizin hydrolase OS=Ovis aries OX=9940 GN=LCT PE=1 SV=1
10	Q8K1F9	2.97e-108	350	566	0.180	0.332	LCTL_MOUSE Lactase-like protein OS=Mus musculus OX=10090 GN=Lctl PE=1 SV=1
11	Q9H227	2.60e-98	320	469	0.170	0.377	GBA3_HUMAN Cytosolic beta-glucosidase OS=Homo sapiens OX=9606 GN=GBA3 PE=1 SV=2
12	Q9FZE0	7.57e-87	291	510	0.163	0.333	BGL40_ARATH Beta-glucosidase 40 OS=Arabidopsis thaliana OX=3702 GN=BGLU40 PE=2 SV=1
13	Q8L7J2	2.69e-85	287	521	0.163	0.326	BGL06_ORYSJ Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
14	Q9FIW4	5.35e-84	282	490	0.160	0.341	BGL42_ARATH Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=1 SV=1
15	Q75I94	2.16e-82	280	568	0.162	0.298	BGL08_ORYSJ Beta-glucosidase 8 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU8 PE=1 SV=1
16	Q75I93	3.77e-80	272	504	0.156	0.323	BGL07_ORYSJ Beta-glucosidase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU7 PE=1 SV=1
17	Q9LV33	9.73e-78	266	512	0.163	0.332	BGL44_ARATH Beta-glucosidase 44 OS=Arabidopsis thaliana OX=3702 GN=BGLU44 PE=2 SV=1
18	Q25BW5	8.85e-77	262	462	0.155	0.351	BGL1A_PHACH Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
19	Q25BW4	9.56e-77	264	540	0.154	0.298	BGL1B_PHACH Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
20	Q7XKV4	4.10e-76	261	510	0.163	0.333	BGL12_ORYSJ Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00232 Glyco_hydro_1	9.7e-197	665.5	Glycosyl hydrolase family 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257408

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292408	0.999	Fibroblast growth factor receptor 4
2	9606.ENSP00000294312	0.999	Fibroblast growth factor 19
3	9606.ENSP00000393312	0.999	Fibroblast growth factor receptor 1
4	9606.ENSP00000471477	0.994	Fibroblast growth factor 21
5	9606.ENSP00000237837	0.974	Fibroblast growth factor 23
6	9606.ENSP00000410294	0.960	Fibroblast growth factor receptor 2
7	9606.ENSP00000263025	0.951	Mitogen-activated protein kinase 3
8	9606.ENSP00000215832	0.929	Mitogen-activated protein kinase 1
9	9606.ENSP00000339824	0.928	Fibroblast growth factor receptor 3
10	9606.ENSP00000256078	0.903	GTPase KRas
11	9606.ENSP00000407586	0.903	GTPase HRas
12	9606.ENSP00000358548	0.900	GTPase NRas
13	9606.ENSP00000447241	0.793	Fibroblast growth factor receptor substrate 2
14	9606.ENSP00000480791	0.757	Fibroblast growth factor 1
15	9606.ENSP00000301645	0.755	Cholesterol 7-alpha-monooxygenase
16	9606.ENSP00000385523	0.746	Peroxisome proliferator-activated receptor alpha
17	9606.ENSP00000447149	0.723	Bile acid receptor
18	9606.ENSP00000369442	0.688	Klotho
19	9606.ENSP00000264498	0.687	Fibroblast growth factor 2
20	9606.ENSP00000168712	0.664	Fibroblast growth factor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.991	catalytic activity
GO:0004553	0.980	hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0015926	0.965	glucosidase activity
GO:0008422	0.922	beta-glucosidase activity
GO:0005102	0.896	signaling receptor binding
GO:0019838	0.626	growth factor binding
GO:0017134	0.578	fibroblast growth factor binding
GO:0070851	0.511	growth factor receptor binding
GO:0005104	0.492	fibroblast growth factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.988	response to stimulus
GO:0009987	0.988	cellular process
GO:0050789	0.985	regulation of biological process
GO:0048518	0.917	positive regulation of biological process
GO:0050794	0.915	regulation of cellular process
GO:0007154	0.875	cell communication
GO:0051716	0.851	cellular response to stimulus
GO:0048522	0.845	positive regulation of cellular process
GO:0023052	0.827	signaling
GO:0007165	0.765	signal transduction
GO:0009719	0.706	response to endogenous stimulus
GO:0008152	0.653	metabolic process
GO:0071704	0.571	organic substance metabolic process
GO:0007169	0.556	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0070848	0.550	response to growth factor
GO:0071363	0.526	cellular response to growth factor stimulus
GO:0044238	0.521	primary metabolic process
GO:0043410	0.469	positive regulation of MAPK cascade
GO:0071774	0.462	response to fibroblast growth factor
GO:0008543	0.452	fibroblast growth factor receptor signaling pathway
GO:0032502	0.406	developmental process
GO:0008284	0.405	positive regulation of cell population proliferation
GO:0044237	0.372	cellular metabolic process
GO:0032501	0.351	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.995	plasma membrane
GO:0043226	0.806	organelle
GO:0043227	0.755	membrane-bounded organelle
GO:0005622	0.726	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.-	0.980	Glycosidases, i.e. enzymes hydrolyzing O- and S-glycosyl compounds.
EC:3.2.1.21	0.922	beta-glucosidase.

[back to server]