StarFunc result for job id Q86Z20

User Input

>input (511 residues)
MSKVARSSSESDVQLWETEEDDMTEGDLGYGLGRKPGGIYEIEFSHRSRKRSDGKNFSPP
PFPRKGEERNEASFQYSKHKSQQDTFPQVSRISNYRRQSSTVDSNSELSNEELRQCLNET
LEEVEMLKTELEASQRQLRGKEEALKILQSMAILGKATSHTQAVLQKTMEQNRSLEKEIN
ALQWEIEFDHNRFKNIEESWIQKYDRLNCENAVLKENLKVKTEEIKMLKSDNAVLNQRYL
EALAMLDIKQQKMAQENMCCDKSGFAEASGLELAVLGACLCHGPGGNPCSCARMAASTRK
LLLQLKQELEILQKSKEEAYVMADAFRIAFEQQLMRKNDQALQLTQMDKMHKKATKWMNW
KHLKEDGFPSPRSKKTFGQRLLGMLPSENSSKRMEDQDSPQEVLKMLIDLLNDKEEALAH
QRKVSYMLARALEDKDTASNENKEKNPIKENFPFNNPWRKTSEFSVLGDPIHSSVCILNS
VGCICSIQHSQIDPNYRTLKRSHSLPSSIIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86Z20	1.000	1.000	5.591E-71	511	1.000	1.000	Q86Z20.pdb.gz	CC125_HUMAN Coiled-coil domain-containing protein 125 OS=Homo sapiens OX=9606 GN=CCDC125 PE=1 SV=2
2	AFDB:A2AUM9	0.137	0.047	2.169E-2	1736	0.194	0.057	A2AUM9.pdb.gz	CE152_MOUSE Centrosomal protein of 152 kDa OS=Mus musculus OX=10090 GN=Cep152 PE=1 SV=1
3	AFDB:Q6PCQ0	0.102	0.074	2.476E-2	778	0.172	0.113	Q6PCQ0.pdb.gz	IQCE_MOUSE IQ domain-containing protein E OS=Mus musculus OX=10090 GN=Iqce PE=1 SV=1
4	AFDB:Q6RCE1	0.093	0.078	5.486E-2	641	0.149	0.119	Q6RCE1.pdb.gz	IFT74_CHLRE Intraflagellar transport protein 74 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT74 PE=1 SV=1
5	AFDB:Q15154	0.114	0.034	7.641E-2	2024	0.168	0.042	Q15154.pdb.gz	PCM1_HUMAN Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=5
6	AFDB:Q38BH9	0.195	0.248	7.641E-2	327	0.114	0.177	Q38BH9.pdb.gz	Q38BH9_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3040 PE=4 SV=1
7	AFDB:Q93635	0.120	0.157	9.321E-2	369	0.145	0.201	Q93635.pdb.gz	CC149_CAEEL Coiled-coil domain-containing protein 149 OS=Caenorhabditis elegans OX=6239 GN=ccdc-149 PE=2 SV=1
8	AFDB:Q9LS42	0.127	0.102	9.960E-2	689	0.102	0.075	Q9LS42.pdb.gz	CASP_ARATH Protein CASP OS=Arabidopsis thaliana OX=3702 GN=CASP PE=1 SV=2
9	AFDB:O94986	0.114	0.045	1.215E-1	1710	0.182	0.054	O94986.pdb.gz	CE152_HUMAN Centrosomal protein of 152 kDa OS=Homo sapiens OX=9606 GN=CEP152 PE=1 SV=4
10	AFDB:P97817	0.149	0.166	1.298E-1	455	0.110	0.123	P97817.pdb.gz	CDR2_MOUSE Cerebellar degeneration-related protein 2 OS=Mus musculus OX=10090 GN=Cdr2 PE=1 SV=2
11	PDB:7r5jV0	0.088	0.160	1.164	273	0.074	0.139	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:7pd3q	0.087	0.200	4.681	198	0.049	0.126	7pd3q.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
13	PDB:6qdvP	0.040	0.127	5.710	106	0.031	0.151	6qdvP.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
14	PDB:6hivCR	0.069	0.099	6.101	314	0.039	0.064	6hivCR.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
15	PDB:4v8mBr	0.064	0.081	6.519	367	0.033	0.046	4v8mBr.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
16	PDB:7f5sLC	0.083	0.110	6.519	368	0.027	0.038	7f5sLC.pdb.gz	METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance.
17	PDB:7wtww	0.044	0.064	7.443	332	0.027	0.042	7wtww.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
18	PDB:6lo8E	0.079	0.316	8.498	80	0.016	0.100	6lo8E.pdb.gz
19	PDB:7o4i1	0.052	0.051	8.498	522	0.029	0.029	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86Z20	0.0	1061	511	1.000	1.000	CC125_HUMAN Coiled-coil domain-containing protein 125 OS=Homo sapiens OX=9606 GN=CCDC125 PE=1 SV=2
2	Q9ZQC5	1.3	34.3	583	0.131	0.115	ICR2_ARATH Interactor of constitutive active ROPs 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ICR2 PE=1 SV=1
3	F1N2N9	1.4	34.3	687	0.074	0.055	ODAD1_BOVIN Outer dynein arm-docking complex subunit 1 OS=Bos taurus OX=9913 GN=ODAD1 PE=1 SV=3
4	A0A1D8PFH4	2.7	33.1	1466	0.078	0.027	A0A1D8PFH4_CANAL Spa2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SPA2 PE=4 SV=1
5	Q8VYU8	4.2	32.3	396	0.053	0.068	ICR5_ARATH Interactor of constitutive active ROPs 5 OS=Arabidopsis thaliana OX=3702 GN=ICR5 PE=1 SV=2
6	Q38CL4	4.5	32.3	366	0.061	0.085	Q38CL4_TRYB2 Peroxisomal membrane protein PEX14 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.100.0130 PE=3 SV=1
7	Q8IEW2	4.5	32.3	366	0.061	0.085	Q8IEW2_TRYBB Peroxisomal membrane protein PEX14 OS=Trypanosoma brucei brucei OX=5702 GN=PEX14 PE=1 SV=1
8	Q91ZX7	5.3	32.3	4545	0.065	0.007	LRP1_MOUSE Prolow-density lipoprotein receptor-related protein 1 OS=Mus musculus OX=10090 GN=Lrp1 PE=1 SV=1
9	Q07954	5.5	32.3	4544	0.065	0.007	LRP1_HUMAN Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens OX=9606 GN=LRP1 PE=1 SV=2
10	Q9BZL4	6.4	32.0	782	0.063	0.041	PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens OX=9606 GN=PPP1R12C PE=1 SV=1
11	Q59FG2	6.7	32.0	2359	0.065	0.014	Q59FG2_HUMAN Low density lipoprotein-related protein 1 variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
12	P11989	7.8	31.2	278	0.041	0.076	BGLG_ECOLI Cryptic beta-glucoside bgl operon antiterminator OS=Escherichia coli (strain K12) OX=83333 GN=bglG PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09789 CC149	40	15.0	Coiled-coil domain-containing protein 149-A
2	PF17767 NAPRTase_N	3.4e+02	12.9	Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379754

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309285	0.803	Coiled-coil domain containing 96
2	9606.ENSP00000238156	0.792	Coiled-coil domain containing 92
3	9606.ENSP00000293845	0.771	Coiled-coil domain-containing protein 42
4	9606.ENSP00000219299	0.737	Coiled-coil domain-containing protein 113
5	9606.ENSP00000380690	0.698	BICD family-like cargo adapter 1
6	9606.ENSP00000242819	0.684	Coiled-coil domain containing 70
7	9606.ENSP00000308873	0.661	Coiled-coil domain containing 74B
8	9606.ENSP00000376250	0.629	Coiled-coil domain-containing protein 50
9	9606.ENSP00000298705	0.559	Protein phosphatase 1 regulatory subunit 36
10	9606.ENSP00000425715	0.540	Coiled-coil domain containing 149

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.895	regulation of cellular process
GO:0048523	0.890	negative regulation of cellular process
GO:0051056	0.869	regulation of small GTPase mediated signal transduction
GO:0043547	0.863	positive regulation of GTPase activity
GO:1902532	0.841	negative regulation of intracellular signal transduction
GO:0040012	0.839	regulation of locomotion
GO:0046578	0.725	regulation of Ras protein signal transduction
GO:0090630	0.724	activation of GTPase activity
GO:0035023	0.724	regulation of Rho protein signal transduction
GO:0051058	0.724	negative regulation of small GTPase mediated signal transduction
GO:0009987	0.709	cellular process
GO:0040013	0.709	negative regulation of locomotion
GO:0046580	0.640	negative regulation of Ras protein signal transduction
GO:2000145	0.597	regulation of cell motility
GO:0071840	0.526	cellular component organization or biogenesis
GO:0016043	0.506	cellular component organization
GO:0006996	0.352	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043226	0.938	organelle
GO:0043229	0.932	intracellular organelle
GO:0043232	0.914	intracellular non-membrane-bounded organelle
GO:0043227	0.751	membrane-bounded organelle
GO:0070013	0.677	intracellular organelle lumen
GO:0043231	0.646	intracellular membrane-bounded organelle
GO:0031981	0.570	nuclear lumen
GO:0005654	0.563	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]