StarFunc result for job id Q8HWS3

User Input

>input (928 residues)
MAKVPELEDTFLQAQPAPQLSPGIQEDCCVQLLGKGLLVYPEETVYLAAEGQPGGEQGGG
EKGEDPELPGAVKSEMHLNNGNFSSEEEDADNHDSKTKAADQYLSQKKTITQIVKDKKKQ
TQLTLQWLEENYIVCEGVCLPRCILYAHYLDFCRKEKLEPACAATFGKTIRQKFPLLTTR
RLGTRGHSKYHYYGIGIKESSAYYHSVYSGKGLTRFSGSKLKNEGGFTRKYSLSSKTGTL
LPEFPSAQHLVYQGCISKDKVDTLIMMYKTHCQCILDNAINGNFEEIQHFLLHFWQGMPD
HLLPLLENPVIIDIFCVCDSILYKVLTDVLIPATMQEMPESLLADIRNFAKNWEQWVVSS
LENLPEALTDKKIPIVRRFVSSLKRQTSFLHLAQIARPALFDQHVVNSMVSDIERVDLNS
IGSQALLTISGSTDTESGIYTEHDSITVFQELKDLLKKNATVEAFIEWLDTVVEQRVIKT
SKQNGRSLKKRAQDFLLKWSFFGARVMHNLTLNNASSFGSFHLIRMLLDEYILLAMETQF
NNDKEQELQNLLDKYMKNSDASKAAFTASPSSCFLANRNKGSMVSSDAVKNESHVETTYL
PLPSSQPGGLGPALHQFPAGNTDNMPLTGQMELSQIAGHLMTPPISPAMASRGSVINQGP
MAGRPPSVGPVLSAPSHCSTYPEPIYPTLPQANHDFYSTSSNYQTVFRAQPHSTSGLYPH
HTEHGRCMAWTEQQLSRDFFSGSCAGSPYNSRPPSSYGPSLQAQDSHNMQFLNTGSFNFL
SNTGAASCQGATLPPNSPNGYYGSNINYPESHRLGSMVNQHVSVISSIRSLPPYSDIHDP
LNILDDSGRKQTSSFYTDTSSPVACRTPVLASSLQTPIPSSSSQCMYGTSNQYPAQETLD
SHGTSSREMVSSLPPINTVFMGTAAGGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8HWS3	1.000	1.000	0.000	928	1.000	1.000	Q8HWS3.pdb.gz	RFX6_HUMAN DNA-binding protein RFX6 OS=Homo sapiens OX=9606 GN=RFX6 PE=1 SV=2
2	AFDB:Q8C7R7	0.718	0.719	1.114E-97	927	0.873	0.874	Q8C7R7.pdb.gz	RFX6_MOUSE DNA-binding protein RFX6 OS=Mus musculus OX=10090 GN=Rfx6 PE=1 SV=2
3	AFDB:X1WD79	0.054	0.047	1.925E-4	1138	0.119	0.097	X1WD79.pdb.gz	X1WD79_DANRE Serine/threonine-protein kinase TAO2 isoform X2 OS=Danio rerio OX=7955 GN=taok2a PE=1 SV=1
4	AFDB:P17672	0.067	0.052	5.848E-4	1355	0.137	0.094	P17672.pdb.gz	E75BA_DROME Ecdysone-induced protein 75B, isoform A OS=Drosophila melanogaster OX=7227 GN=Eip75B PE=2 SV=2
5	AFDB:P22290	0.058	0.053	3.784E-3	1070	0.128	0.111	P22290.pdb.gz	PVDR_PLAVS Duffy receptor OS=Plasmodium vivax (strain Salvador I) OX=126793 GN=PVDR PE=1 SV=2
6	AFDB:Q3ULZ2	0.069	0.062	4.521E-3	1149	0.139	0.112	Q3ULZ2.pdb.gz	FHDC1_MOUSE FH2 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhdc1 PE=1 SV=3
7	AFDB:Q9C0D6	0.070	0.064	7.051E-3	1143	0.141	0.115	Q9C0D6.pdb.gz	FHDC1_HUMAN FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHDC1 PE=1 SV=2
8	AFDB:Q9XZ34	0.089	0.067	7.051E-3	1416	0.107	0.070	Q9XZ34.pdb.gz	RIF1_DROME Telomere-associated protein RIF1 OS=Drosophila melanogaster OX=7227 GN=Rif1 PE=1 SV=1
9	AFDB:P39113	0.077	0.060	8.058E-3	1433	0.122	0.079	P39113.pdb.gz	CAT8_YEAST Regulatory protein CAT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAT8 PE=1 SV=2
10	AFDB:Q9SY69	0.063	0.064	8.807E-3	913	0.126	0.128	Q9SY69.pdb.gz	PPR29_ARATH Pentatricopeptide repeat-containing protein At1g10270 OS=Arabidopsis thaliana OX=3702 GN=GRP23 PE=1 SV=1
11	PDB:1is2A	0.057	0.076	3.645E-1	637	0.066	0.096	1is2A.pdb.gz	Three-dimensional structure of the flavoenzyme acyl-CoA oxidase-II from rat liver, the peroxisomal counterpart of mitochondrial acyl-CoA dehydrogenase.
12	PDB:4jaeA	0.072	0.123	3.645E-1	426	0.050	0.108	4jaeA.pdb.gz	Enzyme-substrate complexes of allosteric citrate synthase: Evidence for a novel intermediate in substrate binding.
13	PDB:1c7dA	0.130	0.297	7.423E-1	284	0.028	0.092	1c7dA.pdb.gz	Genetically crosslinked hemoglobin: a structural study.
14	PDB:7qcdE	0.063	0.172	7.760E-1	261	0.015	0.054	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
15	PDB:4la6A	0.084	0.169	1.013	325	0.038	0.108	4la6A.pdb.gz	Unexpected reactivity of 2-fluorolinalyl diphosphate in the active site of crystalline 2-methylisoborneol synthase.
16	PDB:7rr9A	0.079	0.111	1.013	560	0.043	0.071	7rr9A.pdb.gz	Structures of the human peroxisomal fatty acid transporter ABCD1 in a lipid environment
17	PDB:7l1kB	0.101	0.124	1.512	660	0.060	0.085	7l1kB.pdb.gz	Molecular mechanism of N-terminal acetylation by the ternary NatC complex.
18	PDB:5fj9O	0.084	0.115	1.888	528	0.062	0.110	5fj9O.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
19	PDB:5lhdC	0.069	0.070	2.158	905	0.051	0.052	5lhdC.pdb.gz	Allosteric inhibition of aminopeptidase N functions related to tumor growth and virus infection.
20	PDB:6wpkA	0.076	0.109	2.158	547	0.031	0.053	6wpkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5RJA1	0.0	1085	848	0.625	0.684	RFX6_DANRE DNA-binding protein RFX6 OS=Danio rerio OX=7955 GN=rfx6 PE=2 SV=2
2	Q8C7R7	0.0	1698	927	0.874	0.875	RFX6_MOUSE DNA-binding protein RFX6 OS=Mus musculus OX=10090 GN=Rfx6 PE=1 SV=2
3	Q8HWS3	0.0	1937	928	1.000	1.000	RFX6_HUMAN DNA-binding protein RFX6 OS=Homo sapiens OX=9606 GN=RFX6 PE=1 SV=2
4	Q33E94	2.36e-143	445	735	0.231	0.291	RFX4_HUMAN Transcription factor RFX4 OS=Homo sapiens OX=9606 GN=RFX4 PE=1 SV=2
5	A2BGA0	1.49e-140	438	735	0.227	0.287	RFX4_DANRE Transcription factor RFX4 OS=Danio rerio OX=7955 GN=rfx4 PE=2 SV=1
6	Q7TNK1	1.56e-140	438	735	0.227	0.287	RFX4_MOUSE Transcription factor RFX4 OS=Mus musculus OX=10090 GN=Rfx4 PE=1 SV=1
7	B2GV50	1.07e-76	266	692	0.177	0.237	RFX2_RAT DNA-binding protein RFX2 OS=Rattus norvegicus OX=10116 GN=Rfx2 PE=1 SV=1
8	P48379	6.84e-76	265	717	0.178	0.230	RFX2_MOUSE DNA-binding protein RFX2 OS=Mus musculus OX=10090 GN=Rfx2 PE=1 SV=2
9	Q32NR3	1.00e-75	264	694	0.172	0.231	RFX2_XENLA DNA-binding protein RFX2 OS=Xenopus laevis OX=8355 GN=rfx2 PE=2 SV=1
10	P48378	5.91e-75	262	723	0.172	0.221	RFX2_HUMAN DNA-binding protein RFX2 OS=Homo sapiens OX=9606 GN=RFX2 PE=1 SV=2
11	P48380	2.04e-74	261	749	0.169	0.210	RFX3_HUMAN Transcription factor RFX3 OS=Homo sapiens OX=9606 GN=RFX3 PE=1 SV=2
12	P48381	2.26e-74	261	749	0.169	0.210	RFX3_MOUSE Transcription factor RFX3 OS=Mus musculus OX=10090 GN=Rfx3 PE=1 SV=2
13	P22670	2.17e-73	263	979	0.175	0.165	RFX1_HUMAN MHC class II regulatory factor RFX1 OS=Homo sapiens OX=9606 GN=RFX1 PE=1 SV=2
14	Q5EAP5	1.25e-72	256	734	0.182	0.230	RFX2_DANRE DNA-binding protein RFX2 OS=Danio rerio OX=7955 GN=rfx2 PE=2 SV=1
15	P48377	1.72e-71	257	963	0.175	0.168	RFX1_MOUSE MHC class II regulatory factor RFX1 OS=Mus musculus OX=10090 GN=Rfx1 PE=1 SV=2
16	A0A0B4K621	1.11e-70	253	860	0.177	0.191	A0A0B4K621_DROME Rfx, isoform G OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
17	A8JQX0	1.83e-70	253	889	0.177	0.184	A8JQX0_DROME Rfx, isoform I OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=2
18	A0A0B4KFL4	2.17e-70	253	882	0.177	0.186	A0A0B4KFL4_DROME Rfx, isoform F OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
19	A0A0B4K6P1	2.95e-70	253	911	0.177	0.180	A0A0B4K6P1_DROME Rfx, isoform C OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
20	Q9VGZ6	2.95e-70	253	897	0.177	0.183	Q9VGZ6_DROME Rfx, isoform J OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03288 Pox_D5	3.6e+02	13.1	Poxvirus D5 protein-like
2	PF02257 RFX_DNA_binding	5.6e-27	105.5	RFX DNA-binding domain
3	PF05184 SapB_1	1.5e+02	13.8	Saposin-like type B, region 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332208

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380432	0.949	Insulin
2	9606.ENSP00000242462	0.797	Neurogenin-3
3	9606.ENSP00000333012	0.788	Calcium-responsive transactivator
4	9606.ENSP00000322885	0.776	Probable E3 ubiquitin-protein ligase DTX2
5	9606.ENSP00000339906	0.763	Paired box protein Pax-4
6	9606.ENSP00000374529	0.760	Cyclin-K
7	9606.ENSP00000295108	0.754	Neurogenic differentiation factor 1
8	9606.ENSP00000365687	0.710	Pancreas transcription factor 1 subunit alpha
9	9606.ENSP00000295886	0.700	Homeobox protein Nkx-6.1
10	9606.ENSP00000312631	0.679	Insulinoma-associated protein 1
11	9606.ENSP00000366347	0.676	Homeobox protein Nkx-2.2
12	9606.ENSP00000387662	0.657	Glucagon
13	9606.ENSP00000353734	0.643	Zinc finger protein PLAGL1
14	9606.ENSP00000371398	0.641	Zinc finger protein GLIS3
15	9606.ENSP00000237822	0.628	Lipid droplet-associated hydrolase
16	9606.ENSP00000303960	0.627	ATP-binding cassette sub-family C member 8
17	9606.ENSP00000305071	0.626	DNA-binding protein RFXANK
18	9606.ENSP00000252971	0.624	Motor neuron and pancreas homeobox protein 1
19	9606.ENSP00000357581	0.622	Homeobox protein Nkx-6.2
20	9606.ENSP00000256433	0.617	Immediate early response 3-interacting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.998	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.984	regulation of cellular process
GO:0032501	0.978	multicellular organismal process
GO:0048856	0.977	anatomical structure development
GO:0031018	0.972	endocrine pancreas development
GO:0023051	0.960	regulation of signaling
GO:0010646	0.960	regulation of cell communication
GO:0048518	0.955	positive regulation of biological process
GO:0048522	0.938	positive regulation of cellular process
GO:0090276	0.933	regulation of peptide hormone secretion
GO:0019222	0.890	regulation of metabolic process
GO:0009987	0.884	cellular process
GO:0031323	0.860	regulation of cellular metabolic process
GO:0080090	0.834	regulation of primary metabolic process
GO:0050708	0.828	regulation of protein secretion
GO:0050796	0.817	regulation of insulin secretion
GO:0033500	0.804	carbohydrate homeostasis
GO:0051252	0.800	regulation of RNA metabolic process
GO:0009889	0.779	regulation of biosynthetic process
GO:0031326	0.750	regulation of cellular biosynthetic process
GO:0010556	0.745	regulation of macromolecule biosynthetic process
GO:0006355	0.739	regulation of DNA-templated transcription
GO:0042593	0.722	glucose homeostasis
GO:0006357	0.623	regulation of transcription by RNA polymerase II
GO:0031328	0.539	positive regulation of cellular biosynthetic process
GO:0010557	0.534	positive regulation of macromolecule biosynthetic process
GO:0051173	0.522	positive regulation of nitrogen compound metabolic process
GO:0045935	0.499	positive regulation of nucleobase-containing compound metabolic process
GO:0051047	0.488	positive regulation of secretion
GO:0045893	0.460	positive regulation of DNA-templated transcription
GO:0045944	0.453	positive regulation of transcription by RNA polymerase II
GO:1903532	0.442	positive regulation of secretion by cell
GO:0002793	0.386	positive regulation of peptide secretion
GO:0090277	0.384	positive regulation of peptide hormone secretion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.926	intracellular organelle lumen
GO:0031981	0.848	nuclear lumen
GO:0005737	0.551	cytoplasm
GO:0005654	0.517	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]