StarFunc result for job id Q8IU54

User Input

>input (200 residues)
MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEES
LKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHT
LHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRD
LKYVADGNLCLRTSTHPEST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IU54	1.000	1.000	1.017E-27	200	1.000	1.000	Q8IU54.pdb.gz	IFNL1_HUMAN Interferon lambda-1 OS=Homo sapiens OX=9606 GN=IFNL1 PE=1 SV=1
2	AFDB:Q8IZJ0	0.778	0.778	1.317E-19	200	0.695	0.695	Q8IZJ0.pdb.gz	IFNL2_HUMAN Interferon lambda-2 OS=Homo sapiens OX=9606 GN=IFNL2 PE=2 SV=1
3	AFDB:F1PY54	0.811	0.853	8.203E-19	190	0.695	0.732	F1PY54.pdb.gz	F1PY54_CANLF Interferon 1IB3 OS=Canis lupus familiaris OX=9615 GN=IF1IB3 PE=3 SV=2
4	PDB:3og6A	0.690	0.959	1.701E-17	143	0.710	0.993	3og6A.pdb.gz
5	PDB:5t5wC	0.713	0.938	1.130E-14	151	0.595	0.788	5t5wC.pdb.gz
6	AFDB:Q4VK74	0.786	0.814	1.663E-14	193	0.545	0.565	Q4VK74.pdb.gz	IFNL2_MOUSE Interferon lambda-2 OS=Mus musculus OX=10090 GN=Ifnl2 PE=2 SV=2
7	AFDB:B4ER10	0.708	0.757	1.664E-8	186	0.295	0.317	B4ER10.pdb.gz	IFNL3_CHICK Interferon lambda-3 OS=Gallus gallus OX=9031 GN=IFNL3 PE=2 SV=1
8	AFDB:K9M1U5	0.521	0.572	2.188E-4	179	0.205	0.229	K9M1U5.pdb.gz	IFNL4_HUMAN Interferon lambda-4 OS=Homo sapiens OX=9606 GN=IFNL4 PE=2 SV=1
9	AFDB:Q76KA5	0.394	0.400	9.809E-3	196	0.140	0.143	Q76KA5.pdb.gz
10	AFDB:P07351	0.426	0.452	2.829E-2	186	0.170	0.183	P07351.pdb.gz	IFNA4_MOUSE Interferon alpha-4 OS=Mus musculus OX=10090 GN=Ifna4 PE=3 SV=1
11	AFDB:Q8BQT1	0.327	0.354	4.158E-2	182	0.200	0.220	Q8BQT1.pdb.gz	Q8BQT1_MOUSE Interferon 1ha4 OS=Mus musculus OX=10090 GN=Ifnz PE=2 SV=1
12	PDB:3pivB	0.348	0.418	4.359E-2	157	0.135	0.172	3pivB.pdb.gz
13	AFDB:P20607	0.301	0.289	5.824E-2	211	0.145	0.137	P20607.pdb.gz	IL6_RAT Interleukin-6 OS=Rattus norvegicus OX=10116 GN=Il6 PE=2 SV=1
14	PDB:6weoQ	0.455	0.605	6.106E-2	142	0.115	0.162	6weoQ.pdb.gz	The tissue protective functions of interleukin-22 can be decoupled from pro-inflammatory actions through structure-based design.
15	PDB:1ykbD	0.381	0.499	9.881E-2	142	0.110	0.155	1ykbD.pdb.gz	Structure of insect-cell-derived IL-22.
16	PDB:6gg1A	0.464	0.605	1.198E-1	145	0.110	0.152	6gg1A.pdb.gz
17	PDB:1itfA	0.356	0.414	2.716E-1	165	0.130	0.158	1itfA.pdb.gz
18	PDB:3se4B	0.346	0.430	3.138E-1	143	0.145	0.203	3se4B.pdb.gz
19	PDB:1wu3I	0.370	0.429	3.804E-1	161	0.135	0.168	1wu3I.pdb.gz
20	PDB:1f6fA	0.239	0.254	6.156E-1	183	0.120	0.131	1f6fA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IU54	1.49e-145	404	200	1.000	1.000	IFNL1_HUMAN Interferon lambda-1 OS=Homo sapiens OX=9606 GN=IFNL1 PE=1 SV=1
2	Q8IZI9	1.51e-92	270	196	0.700	0.714	IFNL3_HUMAN Interferon lambda-3 OS=Homo sapiens OX=9606 GN=IFNL3 PE=1 SV=2
3	Q8IZJ0	2.17e-91	267	200	0.695	0.695	IFNL2_HUMAN Interferon lambda-2 OS=Homo sapiens OX=9606 GN=IFNL2 PE=2 SV=1
4	F1PY54	1.48e-85	252	190	0.640	0.674	F1PY54_CANLF Interferon 1IB3 OS=Canis lupus familiaris OX=9615 GN=IF1IB3 PE=3 SV=2
5	Q4VK74	1.44e-65	202	193	0.540	0.560	IFNL2_MOUSE Interferon lambda-2 OS=Mus musculus OX=10090 GN=Ifnl2 PE=2 SV=2
6	Q8CGK6	8.30e-59	184	193	0.505	0.523	IFNL3_MOUSE Interferon lambda-3 OS=Mus musculus OX=10090 GN=Ifnl3 PE=2 SV=1
7	B4ER10	3.27e-26	101	186	0.310	0.333	IFNL3_CHICK Interferon lambda-3 OS=Gallus gallus OX=9031 GN=IFNL3 PE=2 SV=1
8	K9M1U5	0.021	37.0	179	0.270	0.302	IFNL4_HUMAN Interferon lambda-4 OS=Homo sapiens OX=9606 GN=IFNL4 PE=2 SV=1
9	Q6DT37	0.29	34.3	1551	0.105	0.014	MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens OX=9606 GN=CDC42BPG PE=1 SV=2
10	Q728G0	9.0	29.6	637	0.115	0.036	HTPG_DESVH Chaperone protein HtpG OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=htpG PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15177 IL28A	6.6e-69	242.2	Interleukin-28A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329991

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327824	0.998	Interferon lambda receptor 1
2	9606.ENSP00000290200	0.981	Interleukin-10 receptor subunit beta
3	9606.ENSP00000270139	0.857	Interferon alpha/beta receptor 1
4	9606.ENSP00000354394	0.850	Signal transducer and activator of transcription 1-alpha/beta
5	9606.ENSP00000343957	0.835	Interferon alpha/beta receptor 2
6	9606.ENSP00000315768	0.834	Signal transducer and activator of transcription 2
7	9606.ENSP00000431885	0.807	Non-receptor tyrosine-protein kinase TYK2
8	9606.ENSP00000314976	0.804	Interleukin-20 receptor subunit alpha
9	9606.ENSP00000270800	0.798	Interleukin-22 receptor subunit alpha-1
10	9606.ENSP00000328133	0.793	Interleukin-20 receptor subunit beta
11	9606.ENSP00000343204	0.788	Tyrosine-protein kinase JAK1
12	9606.ENSP00000227752	0.776	Interleukin-10 receptor subunit alpha
13	9606.ENSP00000369581	0.775	Interferon beta
14	9606.ENSP00000356713	0.772	Interferon gamma receptor 1
15	9606.ENSP00000290219	0.748	Interferon gamma receptor 2
16	9606.ENSP00000296980	0.748	Interleukin-22 receptor subunit alpha-2
17	9606.ENSP00000327890	0.743	Interleukin-3 receptor subunit alpha
18	9606.ENSP00000229134	0.732	Interleukin-26
19	9606.ENSP00000264657	0.725	Signal transducer and activator of transcription 3
20	9606.ENSP00000276927	0.725	Interferon alpha-1/13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032003	1.000	interleukin-28 receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0050794	0.989	regulation of cellular process
GO:0048583	0.987	regulation of response to stimulus
GO:0009605	0.978	response to external stimulus
GO:0048522	0.978	positive regulation of cellular process
GO:0009966	0.969	regulation of signal transduction
GO:0044419	0.965	biological process involved in interspecies interaction between organisms
GO:0051707	0.957	response to other organism
GO:0042127	0.956	regulation of cell population proliferation
GO:0009967	0.941	positive regulation of signal transduction
GO:0006950	0.938	response to stress
GO:0019222	0.920	regulation of metabolic process
GO:0048519	0.919	negative regulation of biological process
GO:0006952	0.917	defense response
GO:0009615	0.915	response to virus
GO:0048523	0.892	negative regulation of cellular process
GO:0098542	0.870	defense response to other organism
GO:0060255	0.841	regulation of macromolecule metabolic process
GO:0051607	0.822	defense response to virus
GO:0051239	0.786	regulation of multicellular organismal process
GO:0009893	0.777	positive regulation of metabolic process
GO:0010468	0.769	regulation of gene expression
GO:0031323	0.768	regulation of cellular metabolic process
GO:0010604	0.736	positive regulation of macromolecule metabolic process
GO:0002682	0.733	regulation of immune system process
GO:0001817	0.702	regulation of cytokine production
GO:0001819	0.689	positive regulation of cytokine production
GO:0080090	0.655	regulation of primary metabolic process
GO:0051171	0.651	regulation of nitrogen compound metabolic process
GO:0042325	0.636	regulation of phosphorylation
GO:0031325	0.618	positive regulation of cellular metabolic process
GO:0051173	0.616	positive regulation of nitrogen compound metabolic process
GO:0031399	0.610	regulation of protein modification process
GO:0002376	0.607	immune system process
GO:0002684	0.597	positive regulation of immune system process
GO:0009889	0.589	regulation of biosynthetic process
GO:0019219	0.589	regulation of nucleobase-containing compound metabolic process
GO:0051247	0.579	positive regulation of protein metabolic process
GO:0031326	0.566	regulation of cellular biosynthetic process
GO:0009987	0.558	cellular process
GO:0051252	0.529	regulation of RNA metabolic process
GO:0010556	0.528	regulation of macromolecule biosynthetic process
GO:2001141	0.513	regulation of RNA biosynthetic process
GO:1904892	0.509	regulation of receptor signaling pathway via STAT
GO:1904894	0.487	positive regulation of receptor signaling pathway via STAT
GO:0050793	0.486	regulation of developmental process
GO:0050865	0.484	regulation of cell activation
GO:0007154	0.477	cell communication
GO:0051716	0.476	cellular response to stimulus
GO:0023052	0.475	signaling
GO:0007165	0.474	signal transduction
GO:0046425	0.471	regulation of receptor signaling pathway via JAK-STAT
GO:0009892	0.465	negative regulation of metabolic process
GO:0006955	0.462	immune response
GO:0010605	0.456	negative regulation of macromolecule metabolic process
GO:0007166	0.455	cell surface receptor signaling pathway
GO:0042327	0.450	positive regulation of phosphorylation
GO:0001934	0.430	positive regulation of protein phosphorylation
GO:0002694	0.423	regulation of leukocyte activation
GO:1903506	0.406	regulation of nucleic acid-templated transcription
GO:0045595	0.404	regulation of cell differentiation
GO:0022407	0.402	regulation of cell-cell adhesion
GO:0050776	0.394	regulation of immune response
GO:1903037	0.384	regulation of leukocyte cell-cell adhesion
GO:0051249	0.375	regulation of lymphocyte activation
GO:0046427	0.367	positive regulation of receptor signaling pathway via JAK-STAT
GO:0006355	0.366	regulation of DNA-templated transcription
GO:0050863	0.362	regulation of T cell activation
GO:1903706	0.351	regulation of hemopoiesis
GO:0051241	0.309	negative regulation of multicellular organismal process
GO:0050730	0.303	regulation of peptidyl-tyrosine phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005886	0.947	plasma membrane
GO:0032991	0.495	protein-containing complex
GO:0043226	0.486	organelle
GO:0043229	0.460	intracellular organelle
GO:0043227	0.442	membrane-bounded organelle
GO:0005615	0.378	extracellular space
GO:0005737	0.348	cytoplasm
GO:0043235	0.323	receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]