StarFunc result for job id Q8IU68

User Input

>input (726 residues)
MLLPRSVSSERAPGVPEPEELWEAEMERLRGSGTPVRGLPYAMMDKRLIWQLREPAGVQT
LRWQRWQRRRQTVERRLREAAQRLARGLGLWEGALYEIGGLFGTGIRSYFTFLRFLLLLN
LLSLLLTASFVLLPLVWLRPPDPGPTLNLTLQCPGSRQSPPGVLRFHNQLWHVLTGRAFT
NTYLFYGAYRVGPESSSVYSIRLAYLLSPLACLLLCFCGTLRRMVKGLPQKTLLGQGYQA
PLSAKVFSSWDFCIRVQEAATIKKHEISNEFKVELEEGRRFQLMQQQTRAQTACRLLSYL
RVNVLNGLLVVGAISAIFWATKYSQDNKEESLFLLLQYLPPGVIALVNFLGPLLFTFLVQ
LENYPPNTEVNLTLIWCVVLKLASLGMFSVSLGQTILCIGRDKSSCESYGYNVCDYQCWE
NSVGEELYKLSIFNFLLTVAFAFLVTLPRRLLVDRFSGRFWAWLEREEFLVPKNVLDIVA
GQTVTWMGLFYCPLLPLLNSVFLFLTFYIKKYTLLKNSRASSRPFRASSSTFFFQLVLLL
GLLLAAVPLGYVVSSIHSSWDCGLFTNYSAPWQVVPELVALGLPPIGQRALHYLGSHAFS
FPLLIMLSLVLTVCVSQTQANARAIHRLRKQLVWQVQEKWHLVEDLSRLLPEPGPSDSPG
PKYPASQASRPQSFCPGCPCPGSPGHQAPRPGPSVVDAAGLRSPCPGQHGAPASARRFRF
PSGAEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IU68	1.000	1.000	6.418E-97	726	1.000	1.000	Q8IU68.pdb.gz	TMC8_HUMAN Transmembrane channel-like protein 8 OS=Homo sapiens OX=9606 GN=TMC8 PE=1 SV=1
2	AFDB:Q7Z404	0.769	0.783	1.270E-37	712	0.310	0.316	Q7Z404.pdb.gz	TMC4_HUMAN Transmembrane channel-like protein 4 OS=Homo sapiens OX=9606 GN=TMC4 PE=1 SV=3
3	AFDB:Q7Z403	0.663	0.602	3.213E-28	805	0.241	0.217	Q7Z403.pdb.gz	TMC6_HUMAN Transmembrane channel-like protein 6 OS=Homo sapiens OX=9606 GN=TMC6 PE=1 SV=2
4	AFDB:E7FDU7	0.667	0.705	2.801E-27	685	0.218	0.231	E7FDU7.pdb.gz	E7FDU7_DANRE Transmembrane channel-like protein OS=Danio rerio OX=7955 GN=si:dkey-202l16.5 PE=3 SV=1
5	AFDB:Q6UXY8	0.676	0.502	6.777E-27	1006	0.225	0.162	Q6UXY8.pdb.gz	TMC5_HUMAN Transmembrane channel-like protein 5 OS=Homo sapiens OX=9606 GN=TMC5 PE=2 SV=3
6	AFDB:Q8TDI7	0.613	0.506	4.335E-26	906	0.231	0.185	Q8TDI7.pdb.gz	TMC2_HUMAN Transmembrane channel-like protein 2 OS=Homo sapiens OX=9606 GN=TMC2 PE=2 SV=3
7	AFDB:F1QZE9	0.561	0.466	7.367E-26	892	0.237	0.193	F1QZE9.pdb.gz	TMC2B_DANRE Transmembrane channel-like protein 2-B OS=Danio rerio OX=7955 GN=tmc2b PE=2 SV=2
8	AFDB:F1QFU0	0.570	0.456	1.494E-25	935	0.234	0.182	F1QFU0.pdb.gz	TMC1_DANRE Transmembrane channel-like protein 1 OS=Danio rerio OX=7955 GN=tmc1 PE=1 SV=2
9	AFDB:E7FFT2	0.596	0.486	1.561E-25	916	0.241	0.191	E7FFT2.pdb.gz	TMC2A_DANRE Transmembrane channel-like protein 2-A OS=Danio rerio OX=7955 GN=tmc2a PE=1 SV=2
10	AFDB:Q8R4P4	0.597	0.499	1.091E-24	888	0.226	0.185	Q8R4P4.pdb.gz	TMC2_MOUSE Transmembrane channel-like protein 2 OS=Mus musculus OX=10090 GN=Tmc2 PE=1 SV=1
11	PDB:7uswA	0.646	0.758	9.735E-23	608	0.202	0.242	7uswA.pdb.gz	Structures of the TMC-1 complex illuminate mechanosensory transduction.
12	PDB:7zk3A	0.372	0.374	3.226E-5	721	0.069	0.069	7zk3A.pdb.gz	Inhibition mechanism of the chloride channel TMEM16A by the pore blocker 1PBC.
13	PDB:8bc1A	0.347	0.456	6.541E-5	527	0.084	0.116	8bc1A.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
14	PDB:8b8kA	0.359	0.353	1.112E-4	741	0.081	0.080	8b8kA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
15	PDB:8b8jA	0.356	0.364	3.210E-4	709	0.076	0.078	8b8jA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
16	PDB:7b5dA	0.340	0.351	3.355E-4	701	0.076	0.078	7b5dA.pdb.gz
17	PDB:8bc0B	0.316	0.354	3.355E-4	636	0.080	0.091	8bc0B.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
18	PDB:8b8mB	0.315	0.332	4.993E-4	682	0.087	0.092	8b8mB.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
19	PDB:7rx2B	0.283	0.328	5.701E-4	615	0.077	0.091	7rx2B.pdb.gz	TMEM16 scramblases thin the membrane to enable lipid scrambling.
20	PDB:7rxgB	0.273	0.299	6.803E-4	650	0.077	0.086	7rxgB.pdb.gz	TMEM16 scramblases thin the membrane to enable lipid scrambling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IU68	0.0	1462	726	1.000	1.000	TMC8_HUMAN Transmembrane channel-like protein 8 OS=Homo sapiens OX=9606 GN=TMC8 PE=1 SV=1
2	Q7Z404	1.18e-73	254	712	0.303	0.309	TMC4_HUMAN Transmembrane channel-like protein 4 OS=Homo sapiens OX=9606 GN=TMC4 PE=1 SV=3
3	Q6UXY8	1.16e-50	193	1006	0.216	0.156	TMC5_HUMAN Transmembrane channel-like protein 5 OS=Homo sapiens OX=9606 GN=TMC5 PE=2 SV=3
4	E7FDU7	2.76e-40	160	685	0.220	0.234	E7FDU7_DANRE Transmembrane channel-like protein OS=Danio rerio OX=7955 GN=si:dkey-202l16.5 PE=3 SV=1
5	F1QFU0	1.48e-36	150	935	0.216	0.168	TMC1_DANRE Transmembrane channel-like protein 1 OS=Danio rerio OX=7955 GN=tmc1 PE=1 SV=2
6	Q8TDI7	1.43e-35	146	906	0.209	0.168	TMC2_HUMAN Transmembrane channel-like protein 2 OS=Homo sapiens OX=9606 GN=TMC2 PE=2 SV=3
7	Q8R4P4	2.29e-34	143	888	0.198	0.162	TMC2_MOUSE Transmembrane channel-like protein 2 OS=Mus musculus OX=10090 GN=Tmc2 PE=1 SV=1
8	Q3MI88	2.61e-34	142	727	0.205	0.205	Q3MI88_HUMAN Transmembrane channel-like protein (Fragment) OS=Homo sapiens OX=9606 GN=TMC1 PE=2 SV=1
9	E7FFT2	4.75e-34	142	916	0.204	0.162	TMC2A_DANRE Transmembrane channel-like protein 2-A OS=Danio rerio OX=7955 GN=tmc2a PE=1 SV=2
10	A5D8Y1	9.07e-34	140	739	0.202	0.199	A5D8Y1_HUMAN Transmembrane channel-like protein (Fragment) OS=Homo sapiens OX=9606 GN=TMC1 PE=2 SV=1
11	A4FUA6	1.10e-33	140	740	0.202	0.199	A4FUA6_HUMAN Transmembrane channel-like protein (Fragment) OS=Homo sapiens OX=9606 GN=TMC1 PE=2 SV=1
12	A0A0G2KB87	3.18e-32	135	659	0.209	0.231	A0A0G2KB87_RAT Transmembrane channel-like protein OS=Rattus norvegicus OX=10116 GN=Tmc1 PE=3 SV=2
13	Q8R4P5	6.48e-32	135	757	0.207	0.198	TMC1_MOUSE Transmembrane channel-like protein 1 OS=Mus musculus OX=10090 GN=Tmc1 PE=1 SV=1
14	Q7Z403	1.41e-31	134	805	0.231	0.209	TMC6_HUMAN Transmembrane channel-like protein 6 OS=Homo sapiens OX=9606 GN=TMC6 PE=1 SV=2
15	F1QZE9	2.43e-30	130	892	0.226	0.184	TMC2B_DANRE Transmembrane channel-like protein 2-B OS=Danio rerio OX=7955 GN=tmc2b PE=2 SV=2
16	A0A0U1QT59	2.53e-21	102	2036	0.099	0.035	TMC_DROME Transmembrane channel-like protein OS=Drosophila melanogaster OX=7227 GN=Tmc PE=1 SV=1
17	D3KZG3	1.93e-19	96.3	1285	0.077	0.044	TMC1_CAEEL Transmembrane channel-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=tmc-1 PE=1 SV=2
18	A4FU59	1.62e-17	89.0	554	0.150	0.197	A4FU59_HUMAN Transmembrane channel-like protein (Fragment) OS=Homo sapiens OX=9606 GN=TMC1 PE=2 SV=1
19	Q8C5T3	0.004	40.8	152	0.043	0.204	Q8C5T3_MOUSE Transmembrane channel-like protein OS=Mus musculus OX=10090 GN=Tmc1 PE=2 SV=1
20	Q8CCC1	0.065	37.0	131	0.040	0.221	Q8CCC1_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Tmc1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07810 TMC	5e-37	138.2	TMC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325561

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355968	0.981	Zinc transporter 1
2	9606.ENSP00000225777	0.906	Synaptogyrin-2
3	9606.ENSP00000341268	0.805	Tumor necrosis factor receptor type 1-associated DEATH domain protein
4	9606.ENSP00000301634	0.720	Thymidine kinase, cytosolic
5	9606.ENSP00000358966	0.698	Interphotoreceptor matrix proteoglycan 1
6	9606.ENSP00000336783	0.684	Trinucleotide repeat-containing gene 6C protein
7	9606.ENSP00000264228	0.668	Polyprenol reductase
8	9606.ENSP00000304987	0.656	Phakinin
9	9606.ENSP00000247461	0.650	Calnexin
10	9606.ENSP00000364543	0.649	Helicase SKI2W
11	9606.ENSP00000368664	0.598	Regulator of cell cycle RGCC
12	9606.ENSP00000301633	0.558	Baculoviral IAP repeat containing 5
13	9606.ENSP00000394888	0.545	Dedicator of cytokinesis protein 8
14	9606.ENSP00000335040	0.542	Niban-like protein 2
15	9606.ENSP00000219150	0.541	Coronin-1A
16	9606.ENSP00000245157	0.502	Bardet-Biedl syndrome 2 protein
17	9606.ENSP00000465261	0.502	Transmembrane channel-like protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140311	1.000	protein sequestering activity
GO:0019955	1.000	cytokine binding
GO:0043120	0.982	tumor necrosis factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.993	biological regulation
GO:0050794	0.980	regulation of cellular process
GO:0048583	0.868	regulation of response to stimulus
GO:0065009	0.797	regulation of molecular function
GO:0048523	0.789	negative regulation of cellular process
GO:0009987	0.737	cellular process
GO:0009966	0.675	regulation of signal transduction
GO:0048878	0.620	chemical homeostasis
GO:0098771	0.569	inorganic ion homeostasis
GO:0042981	0.519	regulation of apoptotic process
GO:0044087	0.505	regulation of cellular component biogenesis
GO:0044092	0.485	negative regulation of molecular function
GO:0051128	0.458	regulation of cellular component organization
GO:0051129	0.428	negative regulation of cellular component organization
GO:2001233	0.427	regulation of apoptotic signaling pathway
GO:0043254	0.426	regulation of protein-containing complex assembly
GO:0051098	0.419	regulation of binding
GO:0050896	0.415	response to stimulus
GO:2001236	0.376	regulation of extrinsic apoptotic signaling pathway
GO:0055080	0.371	monoatomic cation homeostasis
GO:0055082	0.366	intracellular chemical homeostasis
GO:0031333	0.364	negative regulation of protein-containing complex assembly
GO:0030003	0.361	intracellular monoatomic cation homeostasis
GO:0032091	0.359	negative regulation of protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070062	1.000	extracellular exosome
GO:0012505	0.999	endomembrane system
GO:0005737	0.998	cytoplasm
GO:0005634	0.993	nucleus
GO:0031090	0.986	organelle membrane
GO:0005783	0.922	endoplasmic reticulum
GO:0005794	0.909	Golgi apparatus
GO:0031975	0.893	envelope
GO:0031967	0.850	organelle envelope
GO:0005635	0.804	nuclear envelope
GO:0031965	0.756	nuclear membrane
GO:0071944	0.668	cell periphery
GO:0005886	0.616	plasma membrane
GO:0043233	0.515	organelle lumen
GO:0070013	0.512	intracellular organelle lumen
GO:0031410	0.345	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]