StarFunc result for job id Q8IU85

User Input

>input (385 residues)
MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALK
GKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKD
ASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMST
ACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEF
DSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN
FAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAPSTLCSFISSS
SGVSGVGAERRPRPTTVTAVHSGSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BW96	0.856	0.856	1.000E-60	385	0.977	0.977	Q8BW96.pdb.gz	KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus OX=10090 GN=Camk1d PE=1 SV=2
2	AFDB:Q63450	0.834	0.858	1.620E-51	374	0.709	0.730	Q63450.pdb.gz	KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus OX=10116 GN=Camk1 PE=1 SV=2
3	AFDB:A1L290	0.758	0.745	2.344E-51	392	0.771	0.758	A1L290.pdb.gz
4	AFDB:E7F1H0	0.822	0.828	1.933E-50	382	0.738	0.743	E7F1H0.pdb.gz	E7F1H0_DANRE Calcium/calmodulin-dependent protein kinase Ib OS=Danio rerio OX=7955 GN=camk1b PE=1 SV=1
5	AFDB:B1H1J7	0.748	0.667	4.496E-50	433	0.816	0.725	B1H1J7.pdb.gz	B1H1J7_DANRE Calcium/calmodulin-dependent protein kinase type 1D OS=Danio rerio OX=7955 GN=zgc:172284 PE=2 SV=1
6	AFDB:Q91VB2	0.832	0.676	3.982E-48	477	0.642	0.518	Q91VB2.pdb.gz	KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus OX=10090 GN=Camk1g PE=1 SV=1
7	AFDB:F1QB46	0.760	0.677	4.591E-46	433	0.610	0.543	F1QB46.pdb.gz	F1QB46_DANRE Calcium/calmodulin-dependent protein kinase IG isoform X3 OS=Danio rerio OX=7955 GN=wu:fk61c03 PE=3 SV=1
8	PDB:8bfsA	0.686	0.956	2.954E-45	274	0.709	0.996	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
9	AFDB:O70150	0.792	0.887	1.520E-43	343	0.558	0.627	O70150.pdb.gz	KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus OX=10116 GN=Pnck PE=1 SV=1
10	AFDB:W0LYS5	0.802	0.893	9.631E-43	345	0.561	0.626	W0LYS5.pdb.gz	CAMKI_MACNP Calcium/calmodulin-dependent protein kinase type 1 OS=Macrobrachium nipponense OX=159736 GN=CaMKI PE=2 SV=1
11	AFDB:Q7JMV3	0.736	0.701	1.496E-41	405	0.561	0.533	Q7JMV3.pdb.gz	Q7JMV3_DROME Calcium/calmodulin dependent protein kinase I OS=Drosophila melanogaster OX=7227 GN=CaMKI PE=1 SV=1
12	PDB:5u6yA	0.678	0.573	1.407E-28	459	0.330	0.277	5u6yA.pdb.gz
13	PDB:3soaA	0.640	0.568	7.768E-24	436	0.301	0.266	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
14	PDB:2yaaA	0.666	0.846	4.922E-23	300	0.281	0.360	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
15	PDB:4rgjA	0.616	0.517	4.279E-22	463	0.268	0.222	4rgjA.pdb.gz
16	PDB:6b1uA	0.591	0.518	1.718E-20	442	0.275	0.240	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
17	PDB:4zhxA	0.589	0.556	1.909E-20	409	0.275	0.259	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
18	PDB:7myjC	0.591	0.493	1.909E-20	465	0.286	0.237	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
19	PDB:4d28C	0.588	0.798	2.012E-20	279	0.262	0.362	4d28C.pdb.gz
20	PDB:4cztD	0.580	0.727	6.093E-20	302	0.260	0.331	4cztD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1H1J7	0.0	616	433	0.761	0.677	B1H1J7_DANRE Calcium/calmodulin-dependent protein kinase type 1D OS=Danio rerio OX=7955 GN=zgc:172284 PE=2 SV=1
2	B5MF71	0.0	601	368	0.751	0.785	B5MF71_DANRE Calcium/calmodulin-dependent protein kinase 1Db OS=Danio rerio OX=7955 GN=camk1d PE=2 SV=1
3	B5MF72	0.0	617	392	0.777	0.763	B5MF72_DANRE Calcium/calmodulin-dependent protein kinase 1Db OS=Danio rerio OX=7955 GN=camk1d PE=2 SV=1
4	E7F1H0	0.0	582	382	0.717	0.723	E7F1H0_DANRE Calcium/calmodulin-dependent protein kinase Ib OS=Danio rerio OX=7955 GN=camk1b PE=1 SV=1
5	Q14012	0.0	562	370	0.691	0.719	KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens OX=9606 GN=CAMK1 PE=1 SV=1
6	Q63450	0.0	564	374	0.694	0.714	KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus OX=10116 GN=Camk1 PE=1 SV=2
7	Q8BW96	0.0	785	385	0.977	0.977	KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus OX=10090 GN=Camk1d PE=1 SV=2
8	Q8IU85	0.0	799	385	1.000	1.000	KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens OX=9606 GN=CAMK1D PE=1 SV=1
9	Q91YS8	0.0	563	374	0.694	0.714	KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus OX=10090 GN=Camk1 PE=1 SV=1
10	Q91VB2	6.55e-178	505	477	0.621	0.501	KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus OX=10090 GN=Camk1g PE=1 SV=1
11	Q7TNJ7	8.04e-178	505	476	0.621	0.502	KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus OX=10116 GN=Camk1g PE=2 SV=1
12	Q96NX5	2.83e-176	501	476	0.616	0.498	KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens OX=9606 GN=CAMK1G PE=1 SV=3
13	Q6P965	6.15e-170	483	433	0.582	0.517	Q6P965_DANRE Calcium/calmodulin-dependent protein kinase IG OS=Danio rerio OX=7955 GN=zgc:73155 PE=2 SV=1
14	F1QB46	6.71e-170	483	433	0.582	0.517	F1QB46_DANRE Calcium/calmodulin-dependent protein kinase IG isoform X3 OS=Danio rerio OX=7955 GN=wu:fk61c03 PE=3 SV=1
15	O70150	4.25e-168	475	343	0.564	0.633	KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus OX=10116 GN=Pnck PE=1 SV=1
16	W0LYS5	4.66e-159	452	345	0.558	0.623	CAMKI_MACNP Calcium/calmodulin-dependent protein kinase type 1 OS=Macrobrachium nipponense OX=159736 GN=CaMKI PE=2 SV=1
17	A4V110	3.81e-155	444	390	0.566	0.559	A4V110_DROME Calcium/calmodulin-dependent protein kinase I, isoform I OS=Drosophila melanogaster OX=7227 GN=CaMKI PE=1 SV=1
18	Q9TXJ0	1.87e-154	441	348	0.532	0.589	CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans OX=6239 GN=cmk-1 PE=1 SV=1
19	Q7JMV3	9.32e-151	433	405	0.566	0.538	Q7JMV3_DROME Calcium/calmodulin dependent protein kinase I OS=Drosophila melanogaster OX=7227 GN=CaMKI PE=1 SV=1
20	Q0KIF7	3.22e-124	361	284	0.426	0.577	Q0KIF7_DROME Calcium/calmodulin-dependent protein kinase I, isoform H OS=Drosophila melanogaster OX=7227 GN=CaMKI PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05761 5_nucleotid	49	14.3	5' nucleotidase family
2	PF03109 ABC1	0.34	21.5	ABC1 atypical kinase-like domain
3	PF01636 APH	7.5	17.9	Phosphotransferase enzyme family
4	PF19250 DUF5898	74	14.7	Family of unknown function (DUF5898)
5	PF13095 FTA2	1.6e+02	13.4	Kinetochore Sim4 complex subunit FTA2
6	PF06293 Kdo	1.4	19.8	Lipopolysaccharide kinase (Kdo/WaaP) family
7	PF14531 Kinase-like	0.00051	31.0	Kinase-like
8	PF00069 Pkinase	4e-77	270.7	Protein kinase domain
9	PF17667 Pkinase_fungal	5.2	17.4	Fungal protein kinase
10	PF07714 PK_Tyr_Ser-Thr	3.9e-35	133.0	Protein tyrosine and serine/threonine kinase
11	PF01163 RIO1	5.2	18.2	RIO1 family
12	PF00264 Tyrosinase	2.6e+02	13.3	Common central domain of tyrosinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010364865.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010384370.1	0.888	cAMP responsive element binding protein 1
2	61622.XP_010361255.1	0.887	Belongs to the calmodulin family.
3	61622.XP_010385108.1	0.887	Calmodulin-alpha-like
4	61622.XP_010378236.1	0.831	Produces nitric oxide (NO)
5	61622.XP_010362597.1	0.729	Calmodulin
6	61622.XP_010372142.1	0.729	Calmodulin
7	61622.XP_010375732.1	0.729	Belongs to the calmodulin family.
8	61622.XP_010383641.1	0.727	Cyclic AMP-dependent transcription factor ATF-1 isoform X1
9	61622.XP_010361931.1	0.723	Calmodulin like 4
10	61622.XP_010364794.1	0.707	Calmodulin like 5
11	61622.XP_010350882.1	0.700	Calmodulin like 6
12	61622.XP_010364795.1	0.700	Belongs to the calmodulin family.
13	61622.XP_010387690.1	0.685	cAMP responsive element modulator
14	61622.XP_010366625.1	0.679	Calcium/calmodulin-dependent protein kinase kinase 2
15	61622.XP_010380497.1	0.669	Calcium/calmodulin-dependent protein kinase kinase 1
16	61622.XP_010364288.1	0.649	acyl-CoA-binding domain-containing protein 7
17	61622.XP_010387584.1	0.649	Cyclic AMP-dependent transcription factor ATF-4
18	61622.XP_010364871.1	0.644	Required for S phase entry of the cell cycle.
19	61622.XP_010380449.1	0.644	Myocyte-specific enhancer factor 2A isoform X1
20	61622.XP_010366369.1	0.639	DnaJ heat shock protein family (Hsp40) member C15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005515	0.999	protein binding
GO:0004683	0.986	calmodulin-dependent protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0048522	0.954	positive regulation of cellular process
GO:0019222	0.935	regulation of metabolic process
GO:0050920	0.849	regulation of chemotaxis
GO:0002688	0.841	regulation of leukocyte chemotaxis
GO:0009987	0.825	cellular process
GO:0060255	0.787	regulation of macromolecule metabolic process
GO:0071622	0.787	regulation of granulocyte chemotaxis
GO:0009893	0.770	positive regulation of metabolic process
GO:0051171	0.767	regulation of nitrogen compound metabolic process
GO:0080090	0.765	regulation of primary metabolic process
GO:0031323	0.755	regulation of cellular metabolic process
GO:0044093	0.750	positive regulation of molecular function
GO:0008152	0.615	metabolic process
GO:0071704	0.605	organic substance metabolic process
GO:0044238	0.587	primary metabolic process
GO:0006807	0.566	nitrogen compound metabolic process
GO:0044237	0.538	cellular metabolic process
GO:0010604	0.534	positive regulation of macromolecule metabolic process
GO:0043170	0.499	macromolecule metabolic process
GO:0050896	0.454	response to stimulus
GO:0051173	0.454	positive regulation of nitrogen compound metabolic process
GO:0031325	0.446	positive regulation of cellular metabolic process
GO:0009889	0.444	regulation of biosynthetic process
GO:0010468	0.415	regulation of gene expression
GO:0019219	0.414	regulation of nucleobase-containing compound metabolic process
GO:0032501	0.412	multicellular organismal process
GO:0048519	0.409	negative regulation of biological process
GO:0048523	0.404	negative regulation of cellular process
GO:0031326	0.404	regulation of cellular biosynthetic process
GO:0010556	0.400	regulation of macromolecule biosynthetic process
GO:0051252	0.393	regulation of RNA metabolic process
GO:0006355	0.371	regulation of DNA-templated transcription
GO:0048856	0.325	anatomical structure development
GO:1901564	0.314	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.985	nucleus
GO:0005829	0.938	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.17	0.986	calcium/calmodulin-dependent protein kinase.

[back to server]