StarFunc result for job id Q8IU99

User Input

>input (346 residues)
MMDKFRMIFQFLQSNQESFMNGICGIMALASAQMYSAFDFNCPCLPGYNAAYSAGILLAP
PLVLFLLGLVMNNNVSMLAEEWKRPLGRRAKDPAVLRYMFCSMAQRALIAPVVWVAVTLL
DGKCFLCAFCTAVPVSALGNGSLAPGLPAPELARLLARVPCPEIYDGDWLLAREVAVRYL
RCISQALGWSFVLLTTLLAFVVRSVRPCFTQAAFLKSKYWSHYIDIERKLFDETCTEHAK
AFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMN
RLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z291	0.681	0.677	2.009E-36	348	0.919	0.914	D3Z291.pdb.gz	CAHM1_MOUSE Calcium homeostasis modulator protein 1 OS=Mus musculus OX=10090 GN=Calhm1 PE=1 SV=1
2	AFDB:Q86XJ0	0.819	0.823	1.640E-23	344	0.457	0.459	Q86XJ0.pdb.gz	CAHM3_HUMAN Calcium homeostasis modulator protein 3 OS=Homo sapiens OX=9606 GN=CALHM3 PE=1 SV=2
3	AFDB:J3QMI4	0.764	0.762	1.095E-21	347	0.431	0.429	J3QMI4.pdb.gz	CAHM3_MOUSE Calcium homeostasis modulator protein 3 OS=Mus musculus OX=10090 GN=Calhm3 PE=1 SV=1
4	PDB:6vamA	0.549	0.855	4.376E-19	214	0.494	0.799	6vamA.pdb.gz
5	PDB:6valA	0.555	0.723	6.523E-16	257	0.402	0.541	6valA.pdb.gz
6	AFDB:Q9HA72	0.610	0.647	1.115E-10	323	0.249	0.266	Q9HA72.pdb.gz	CAHM2_HUMAN Calcium homeostasis modulator protein 2 OS=Homo sapiens OX=9606 GN=CALHM2 PE=1 SV=1
7	PDB:6uiwA	0.525	0.603	4.753E-9	294	0.225	0.265	6uiwA.pdb.gz	The structures and gating mechanism of human calcium homeostasis modulator 2.
8	AFDB:Q5R3K3	0.531	0.576	3.682E-8	315	0.214	0.235	Q5R3K3.pdb.gz	CAHM6_HUMAN Calcium homeostasis modulator protein 6 OS=Homo sapiens OX=9606 GN=CALHM6 PE=1 SV=1
9	PDB:6ytvA	0.438	0.573	4.574E-7	252	0.214	0.294	6ytvA.pdb.gz
10	AFDB:Q18593	0.486	0.506	2.694E-6	329	0.171	0.179	Q18593.pdb.gz	CLHM1_CAEEL Calcium homeostasis modulator protein OS=Caenorhabditis elegans OX=6239 GN=clhm-1 PE=1 SV=2
11	PDB:6lomA	0.449	0.515	6.769E-6	295	0.142	0.166	6lomA.pdb.gz
12	AFDB:P91124	0.143	0.126	8.966E-2	430	0.136	0.109	P91124.pdb.gz	RIC19_CAEEL Resistance to inhibitors of cholinesterase protein 19 OS=Caenorhabditis elegans OX=6239 GN=ric-19 PE=1 SV=2
13	AFDB:P9WI25	0.127	0.114	1.292E-1	396	0.118	0.104	P9WI25.pdb.gz	PPE19_MYCTU Uncharacterized PPE family protein PPE19 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=PPE19 PE=3 SV=1
14	AFDB:Q9VK91	0.126	0.115	1.862E-1	395	0.130	0.114	Q9VK91.pdb.gz	FAM92_DROME CBY1-interacting BAR domain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=Fam92 PE=1 SV=2
15	AFDB:P53747	0.110	0.139	2.339E-1	219	0.098	0.155	P53747.pdb.gz	YN8Z_YEAST Uncharacterized vacuolar membrane protein YNR061C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNR061C PE=1 SV=1
16	PDB:7ungD3	0.136	0.139	8.469E-1	317	0.121	0.132	7ungD3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
17	PDB:6l7oD	0.092	0.068	9.712E-1	504	0.101	0.069	6l7oD.pdb.gz	Structural insights into NDH-1 mediated cyclic electron transfer.
18	PDB:7ungD2	0.169	0.157	1.400	398	0.110	0.095	7ungD2.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
19	PDB:4ntaA	0.146	0.274	1.465	147	0.043	0.102	4ntaA.pdb.gz
20	PDB:5nrlA	0.098	0.028	1.465	2216	0.064	0.010	5nrlA.pdb.gz	Structure of a pre-catalytic spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z291	0.0	647	348	0.925	0.920	CAHM1_MOUSE Calcium homeostasis modulator protein 1 OS=Mus musculus OX=10090 GN=Calhm1 PE=1 SV=1
2	Q8IU99	0.0	716	346	1.000	1.000	CAHM1_HUMAN Calcium homeostasis modulator protein 1 OS=Homo sapiens OX=9606 GN=CALHM1 PE=1 SV=2
3	Q86XJ0	6.07e-96	290	344	0.462	0.465	CAHM3_HUMAN Calcium homeostasis modulator protein 3 OS=Homo sapiens OX=9606 GN=CALHM3 PE=1 SV=2
4	J3QMI4	4.08e-91	278	347	0.431	0.429	CAHM3_MOUSE Calcium homeostasis modulator protein 3 OS=Mus musculus OX=10090 GN=Calhm3 PE=1 SV=1
5	Q9HA72	2.40e-33	127	323	0.231	0.248	CAHM2_HUMAN Calcium homeostasis modulator protein 2 OS=Homo sapiens OX=9606 GN=CALHM2 PE=1 SV=1
6	Q5R3K3	1.79e-24	103	315	0.228	0.251	CAHM6_HUMAN Calcium homeostasis modulator protein 6 OS=Homo sapiens OX=9606 GN=CALHM6 PE=1 SV=1
7	Q18593	4.70e-10	62.4	329	0.153	0.161	CLHM1_CAEEL Calcium homeostasis modulator protein OS=Caenorhabditis elegans OX=6239 GN=clhm-1 PE=1 SV=2
8	Q9VT41	0.35	35.4	1001	0.124	0.043	INT7_DROME Integrator complex subunit 7 OS=Drosophila melanogaster OX=7227 GN=defl PE=1 SV=1
9	Q09744	3.1	32.3	571	0.052	0.032	YB63_SCHPO Uncharacterized FAD-binding protein C12C2.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC12C2.03c PE=3 SV=1
10	P47101	5.2	31.6	745	0.046	0.021	YJ00_YEAST UPF0508 protein YJR030C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YJR030C PE=3 SV=3
11	Q9UTP5	5.6	31.2	264	0.058	0.076	MU162_SCHPO Meiotically up-regulated gene 162 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug162 PE=1 SV=1
12	O74412	8.7	30.8	963	0.058	0.021	CBF12_SCHPO Transcription factor cbf12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cbf12 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14798 Ca_hom_mod	1.2e-85	298.2	Calcium homeostasis modulator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329926

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386306	0.822	Sodium channel protein type 9 subunit alpha
2	9606.ENSP00000283254	0.817	Sodium channel protein type 3 subunit alpha
3	9606.ENSP00000364586	0.811	Sodium channel protein type 2 subunit alpha
4	9606.ENSP00000227638	0.810	Pannexin-1
5	9606.ENSP00000480090	0.777	Polycystic kidney disease protein 1-like 3
6	9606.ENSP00000155858	0.770	Transient receptor potential cation channel subfamily M member 5
7	9606.ENSP00000284288	0.697	Pannexin-3
8	9606.ENSP00000379183	0.680	Pannexin-2
9	9606.ENSP00000305721	0.674	Inhibitor of Bruton tyrosine kinase
10	9606.ENSP00000389714	0.642	Catenin alpha-3
11	9606.ENSP00000300061	0.629	Amiloride-sensitive sodium channel subunit gamma
12	9606.ENSP00000325296	0.621	Polycystic kidney disease 2-like 1 protein
13	9606.ENSP00000260402	0.606	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
14	9606.ENSP00000376227	0.604	Transmembrane protein 44
15	9606.ENSP00000344411	0.600	Taste receptor type 1 member 3
16	9606.ENSP00000353292	0.599	Amiloride-sensitive sodium channel subunit alpha
17	9606.ENSP00000345751	0.589	Amiloride-sensitive sodium channel subunit beta
18	9606.ENSP00000343339	0.576	P2X purinoceptor 2
19	9606.ENSP00000364520	0.558	Taste receptor type 1 member 2
20	9606.ENSP00000263314	0.548	P2X purinoceptor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005244	1.000	voltage-gated monoatomic ion channel activity
GO:0005515	0.993	protein binding
GO:1901702	0.969	salt transmembrane transporter activity
GO:0008324	0.969	monoatomic cation transmembrane transporter activity
GO:0005261	0.960	monoatomic cation channel activity
GO:0015318	0.956	inorganic molecular entity transmembrane transporter activity
GO:0022890	0.932	inorganic cation transmembrane transporter activity
GO:0046873	0.921	metal ion transmembrane transporter activity
GO:0022843	0.842	voltage-gated monoatomic cation channel activity
GO:0005262	0.835	calcium channel activity
GO:0005245	0.832	voltage-gated calcium channel activity
GO:0005227	0.754	calcium activated cation channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051234	0.991	establishment of localization
GO:0051259	0.991	protein complex oligomerization
GO:0006810	0.982	transport
GO:0050789	0.977	regulation of biological process
GO:0050794	0.924	regulation of cellular process
GO:0050877	0.901	nervous system process
GO:0006811	0.890	monoatomic ion transport
GO:0007600	0.863	sensory perception
GO:0050909	0.684	sensory perception of taste
GO:0071702	0.683	organic substance transport
GO:0032879	0.606	regulation of localization
GO:0051049	0.570	regulation of transport
GO:0006812	0.546	monoatomic cation transport
GO:0050896	0.346	response to stimulus
GO:1901264	0.339	carbohydrate derivative transport
GO:0071705	0.323	nitrogen compound transport
GO:0051260	0.320	protein homooligomerization
GO:0034762	0.318	regulation of transmembrane transport
GO:0015748	0.317	organophosphate ester transport
GO:0034765	0.311	regulation of monoatomic ion transmembrane transport
GO:0015931	0.309	nucleobase-containing compound transport
GO:0051291	0.306	protein heterooligomerization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0098590	0.753	plasma membrane region
GO:0045178	0.417	basal part of cell
GO:0016323	0.409	basolateral plasma membrane
GO:0043227	0.387	membrane-bounded organelle
GO:0005737	0.386	cytoplasm
GO:0043229	0.328	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.836	Ca(2+)(in) = Ca(2+)(out)

[back to server]