StarFunc result for job id Q8IUA0

User Input

>input (241 residues)
MWTVRTEGGHFPLHSPTFSWRNVAFLLLLSLALEWTSAMLTKKIKHKPGLCPKERLTCTT
ELPDSCNTDFDCKEYQKCCFFACQKKCMDPFQEPCMLPVRHGNCNHEAQRWHFDFKNYRC
TPFKYRGCEGNANNFLNEDACRTACMLIVKDGQCPLFPFTERKECPPSCHSDIDCPQTDK
CCESRCGFVCARAWTVKKGFCPRKPLLCTKIDKPKCLQDEECPLVEKCCSHCGLKCMDPR
R

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9DA01	0.374	0.643	3.998E-10	134	0.191	0.343	Q9DA01.pdb.gz	EPPI_MOUSE Eppin OS=Mus musculus OX=10090 GN=Eppin PE=1 SV=1
2	AFDB:O95925	0.373	0.645	9.662E-10	133	0.187	0.338	O95925.pdb.gz	EPPI_HUMAN Eppin OS=Homo sapiens OX=9606 GN=EPPIN PE=1 SV=1
3	AFDB:Q8IUB2	0.123	0.129	8.293E-6	231	0.257	0.268	Q8IUB2.pdb.gz	WFDC3_HUMAN WAP four-disulfide core domain protein 3 OS=Homo sapiens OX=9606 GN=WFDC3 PE=1 SV=1
4	AFDB:Q5ZR42	0.242	0.033	1.584E-5	2007	0.112	0.013	Q5ZR42.pdb.gz	Q5ZR42_CAEEL BPTI/Kunitz inhibitor domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mec-1 PE=1 SV=2
5	AFDB:Q9EPX2	0.224	0.046	2.852E-5	1280	0.154	0.029	Q9EPX2.pdb.gz	PPN_MOUSE Papilin OS=Mus musculus OX=10090 GN=Papln PE=2 SV=2
6	AFDB:Q2UY11	0.224	0.049	3.208E-5	1141	0.112	0.024	Q2UY11.pdb.gz	COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus OX=10090 GN=Col28a1 PE=2 SV=1
7	AFDB:O76840	0.230	0.027	3.608E-5	2167	0.100	0.011	O76840.pdb.gz	PPN1_CAEEL Papilin OS=Caenorhabditis elegans OX=6239 GN=mig-6 PE=1 SV=1
8	AFDB:G3V7D5	0.224	0.234	3.827E-5	230	0.091	0.096	G3V7D5.pdb.gz	G3V7D5_RAT Tissue factor pathway inhibitor OS=Rattus norvegicus OX=10116 GN=Tfpi2 PE=4 SV=1
9	AFDB:P86862	0.218	0.793	3.827E-5	65	0.083	0.308	P86862.pdb.gz	VKT1_ANTEL KappaPI-actitoxin-Ael3a OS=Anthopleura elegantissima OX=6110 PE=1 SV=1
10	AFDB:P02760	0.217	0.149	4.304E-5	352	0.091	0.062	P02760.pdb.gz	AMBP_HUMAN Protein AMBP OS=Homo sapiens OX=9606 GN=AMBP PE=1 SV=1
11	PDB:4bd9B	0.226	0.325	1.022E-4	165	0.087	0.127	4bd9B.pdb.gz	A Noncanonical Mechanism of Carboxypeptidase Inhibition Revealed by the Crystal Structure of the Tri-Kunitz Smci in Complex with Human Cpa4.
12	PDB:3bybA	0.220	0.888	1.150E-4	58	0.079	0.328	3bybA.pdb.gz
13	PDB:2m01A	0.210	0.761	1.809E-2	59	0.071	0.288	2m01A.pdb.gz
14	PDB:3s8mA	0.089	0.056	2.845	390	0.021	0.013	3s8mA.pdb.gz
15	PDB:5lpeA	0.081	0.093	4.555	204	0.029	0.034	5lpeA.pdb.gz	Structural basis for the Zn2+ inhibition of the zymogen-like kallikrein-related peptidase 10.
16	PDB:4niyD	0.071	0.085	4.831	195	0.029	0.036	4niyD.pdb.gz	N-terminal protein modification by substrate-activated reverse proteolysis.
17	PDB:3rfzB	0.064	0.029	5.124	778	0.041	0.013	3rfzB.pdb.gz
18	PDB:4eueA	0.105	0.066	5.434	398	0.017	0.010	4eueA.pdb.gz	Structures of trans-2-enoyl-CoA reductases from Clostridium acetobutylicum and Treponema denticola: insights into the substrate specificity and the catalytic mechanism
19	PDB:4fbgD	0.091	0.057	5.434	401	0.017	0.010	4fbgD.pdb.gz	Structures of trans-2-enoyl-CoA reductases from Clostridium acetobutylicum and Treponema denticola: insights into the substrate specificity and the catalytic mechanism
20	PDB:2qskA	0.081	0.189	5.763	95	0.079	0.200	2qskA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9DA01	8.44e-20	84.3	134	0.195	0.351	EPPI_MOUSE Eppin OS=Mus musculus OX=10090 GN=Eppin PE=1 SV=1
2	O95925	1.23e-15	73.2	133	0.162	0.293	EPPI_HUMAN Eppin OS=Homo sapiens OX=9606 GN=EPPIN PE=1 SV=1
3	Q96NZ8	2.83e-08	55.8	548	0.108	0.047	WFKN1_HUMAN WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 OS=Homo sapiens OX=9606 GN=WFIKKN1 PE=1 SV=1
4	Q8TEU8	3.13e-08	55.8	576	0.108	0.045	WFKN2_HUMAN WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 OS=Homo sapiens OX=9606 GN=WFIKKN2 PE=1 SV=1
5	Q8R0S6	3.38e-08	55.8	552	0.108	0.047	WFKN1_MOUSE WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 OS=Mus musculus OX=10090 GN=Wfikkn1 PE=2 SV=2
6	Q868Z9	5.55e-08	55.5	2898	0.116	0.010	PPN_DROME Papilin OS=Drosophila melanogaster OX=7227 GN=Ppn PE=1 SV=2
7	P84875	1.65e-07	51.6	165	0.112	0.164	PCPI_SABMA Carboxypeptidase inhibitor SmCI OS=Sabellastarte magnifica OX=389514 PE=1 SV=1
8	Q7TQN3	3.57e-07	52.8	571	0.104	0.044	WFKN2_MOUSE WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 OS=Mus musculus OX=10090 GN=Wfikkn2 PE=1 SV=2
9	P48307	4.03e-07	51.6	235	0.108	0.111	TFPI2_HUMAN Tissue factor pathway inhibitor 2 OS=Homo sapiens OX=9606 GN=TFPI2 PE=1 SV=1
10	B0V0E5	5.03e-07	52.4	751	0.087	0.028	B0V0E5_DANRE Amyloid-beta A4 protein OS=Danio rerio OX=7955 GN=appb PE=1 SV=1
11	Q1WCN6	5.98e-07	51.2	233	0.112	0.116	Q1WCN6_DANRE Tissue factor pathway inhibitor OS=Danio rerio OX=7955 GN=si:ch211-262k23.2 PE=2 SV=1
12	Q9EPX2	8.87e-07	51.6	1280	0.100	0.019	PPN_MOUSE Papilin OS=Mus musculus OX=10090 GN=Papln PE=2 SV=2
13	Q9BQY6	1.06e-06	48.9	131	0.162	0.298	WFDC6_HUMAN WAP four-disulfide core domain protein 6 OS=Homo sapiens OX=9606 GN=WFDC6 PE=1 SV=1
14	O76840	1.27e-06	51.2	2167	0.095	0.011	PPN1_CAEEL Papilin OS=Caenorhabditis elegans OX=6239 GN=mig-6 PE=1 SV=1
15	F1SKM1	1.39e-06	51.2	2938	0.091	0.007	F1SKM1_PIG Collagen type VII alpha 1 chain OS=Sus scrofa OX=9823 GN=COL7A1 PE=4 SV=2
16	P86733	1.40e-06	48.5	126	0.108	0.206	KCP_HALAI BPTI/Kunitz domain-containing protein (Fragment) OS=Haliotis asinina OX=109174 PE=1 SV=1
17	P02760	1.41e-06	50.4	352	0.120	0.082	AMBP_HUMAN Protein AMBP OS=Homo sapiens OX=9606 GN=AMBP PE=1 SV=1
18	Q64240	1.73e-06	50.4	349	0.104	0.072	AMBP_RAT Protein AMBP OS=Rattus norvegicus OX=10116 GN=Ambp PE=1 SV=1
19	B2G331	2.84e-06	46.2	78	0.095	0.295	VKT2B_HETCR TauPI-stichotoxin-Hcr2b OS=Heteractis crispa OX=175771 PE=1 SV=1
20	P15943	3.13e-06	50.1	765	0.091	0.029	APLP2_RAT Amyloid beta precursor like protein 2 OS=Rattus norvegicus OX=10116 GN=Aplp2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00014 Kunitz_BPTI	2.9e-12	57.9	Kunitz/Bovine pancreatic trypsin inhibitor domain
2	PF00095 WAP	1.5e-20	84.6	WAP-type (Whey Acidic Protein) 'four-disulfide core'

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361735

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348968	0.911	Protein WFDC11
2	9606.ENSP00000279058	0.903	Serine peptidase inhibitor, Kunitz type 4
3	9606.ENSP00000361755	0.850	WAP four-disulfide core domain containing
4	9606.ENSP00000320532	0.802	Protein WFDC9
5	9606.ENSP00000302938	0.718	WAP four-disulfide core domain protein 13
6	9606.ENSP00000361726	0.713	WAP four-disulfide core domain containing
7	9606.ENSP00000361867	0.701	Semenogelin-1
8	9606.ENSP00000361855	0.694	Semenogelin-2
9	9606.ENSP00000389277	0.656	Bax inhibitor 1
10	9606.ENSP00000219334	0.651	Sphingomyelin phosphodiesterase 3
11	9606.ENSP00000217428	0.625	Serine peptidase inhibitor, Kunitz type 3
12	9606.ENSP00000361875	0.564	WAP four-disulfide core domain protein 5
13	9606.ENSP00000342098	0.536	Kunitz-type protease inhibitor 1
14	9606.ENSP00000301244	0.535	Kunitz-type protease inhibitor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030414	0.998	peptidase inhibitor activity
GO:0005515	0.995	protein binding
GO:0004866	0.988	endopeptidase inhibitor activity
GO:0004867	0.891	serine-type endopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.860	biological regulation
GO:0050789	0.841	regulation of biological process
GO:0048519	0.718	negative regulation of biological process
GO:0009987	0.493	cellular process
GO:0071704	0.331	organic substance metabolic process
GO:0050794	0.305	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005576	0.989	extracellular region
GO:0016020	0.976	membrane
GO:0071944	0.948	cell periphery
GO:0005615	0.863	extracellular space
GO:0043227	0.815	membrane-bounded organelle
GO:0005622	0.807	intracellular anatomical structure
GO:0005886	0.607	plasma membrane
GO:0043231	0.536	intracellular membrane-bounded organelle
GO:0031982	0.522	vesicle
GO:0012505	0.412	endomembrane system
GO:0005737	0.389	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]