StarFunc result for job id Q8IUA7

User Input

>input (1624 residues)
MSKRRMSVGQQTWALLCKNCLKKWRMKRQTLLEWLFSFLLVLFLYLFFSNLHQVHDTPQM
SSMDLGRVDSFNDTNYVIAFAPESKTTQEIMNKVASAPFLKGRTIMGWPDEKSMDELDLN
YSIDAVRVIFTDTFSYHLKFSWGHRIPMMKEHRDHSAHCQAVNEKMKCEGSEFWEKGFVA
FQAAINAAIIEIATNHSVMEQLMSVTGVHMKILPFVAQGGVATDFFIFFCIISFSTFIYY
VSVNVTQERQYITSLMTMMGLRESAFWLSWGLMYAGFILIMATLMALIVKSAQIVVLTGF
VMVFTLFLLYGLSLITLAFLMSVLIKKPFLTGLVVFLLIVFWGILGFPALYTRLPAFLEW
TLCLLSPFAFTVGMAQLIHLDYDVNSNAHLDSSQNPYLIIATLFMLVFDTLLYLVLTLYF
DKILPAEYGHRCSPLFFLKSCFWFQHGRANHVVLENETDSDPTPNDCFEPVSPEFCGKEA
IRIKNLKKEYAGKCERVEALKGVVFDIYEGQITALLGHSGAGKTTLLNILSGLSVPTSGS
VTVYNHTLSRMADIENISKFTGFCPQSNVQFGFLTVKENLRLFAKIKGILPHEVEKEVQR
VVQELEMENIQDILAQNLSGGQNRKLTFGIAILGDPQVLLLDEPTAGLDPLSRHRIWNLL
KEGKSDRVILFSTQFIDEADILADRKVFISNGKLKCAGSSLFLKKKWGIGYHLSLHLNER
CDPESITSLVKQHISDAKLTAQSEEKLVYILPLERTNKFPELYRDLDRCSNQGIEDYGVS
ITTLNEVFLKLEGKSTIDESDIGIWGQLQTDGAKDIGSLVELEQVLSSFHETRKTISGVA
LWRQQVCAIAKVRFLKLKKERKSLWTILLLFGISFIPQLLEHLFYESYQKSYPWELSPNT
YFLSPGQQPQDPLTHLLVINKTGSTIDNFLHSLRRQNIAIEVDAFGTRNGTDDPSYNGAI
IVSGDEKDHRFSIACNTKRLNCFPVLLDVISNGLLGIFNSSEHIQTDRSTFFEEHMDYEY
GYRSNTFFWIPMAASFTPYIAMSSIGDYKKKAHSQLRISGLYPSAYWFGQALVDVSLYFL
ILLLMQIMDYIFSPEEIIFIIQNLLIQILCSIGYVSSLVFLTYVISFIFRNGRKNSGIWS
FFFLIVVIFSIVATDLNEYGFLGLFFGTMLIPPFTLIGSLFIFSEISPDSMDYLGASESE
IVYLALLIPYLHFLIFLFILRCLEMNCRKKLMRKDPVFRISPRSNAIFPNPEEPEGEEED
IQMERMRTVNAMAVRDFDETPVIIASCLRKEYAGKKKNCFSKRKKKIATRNVSFCVKKGE
VIGLLGHNGAGKSTTIKMITGDTKPTAGQVILKGSGGGEPLGFLGYCPQENALWPNLTVR
QHLEVYAAVKGLRKGDAMIAITRLVDALKLQDQLKAPVKTLSEGIKRKLCFVLSILGNPS
VVLLDEPSTGMDPEGQQQMWQVIRATFRNTERGALLTTHYMAEAEAVCDRVAIMVSGRLR
CIGSIQHLKSKFGKDYLLEMKLKNLAQMEPLHAEILRLFPQAAQQERFSSLMVYKLPVED
VRPLSQAFFKLEIVKQSFDLEEYSLSQSTLEQVFLELSKEQELGDLEEDFDPSVKWKLLL
QEEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94911	0.969	0.970	0.000	1621	0.717	0.719	O94911.pdb.gz	ABCA8_HUMAN ABC-type organic anion transporter ABCA8 OS=Homo sapiens OX=9606 GN=ABCA8 PE=1 SV=4
2	AFDB:Q8CF82	0.919	0.909	0.000	1642	0.411	0.406	Q8CF82.pdb.gz	ABCA5_RAT Cholesterol transporter ABCA5 OS=Rattus norvegicus OX=10116 GN=Abca5 PE=2 SV=1
3	AFDB:Q8K440	0.977	0.979	0.000	1620	0.657	0.659	Q8K440.pdb.gz	ABC8B_MOUSE ABC-type organic anion transporter ABCA8B OS=Mus musculus OX=10090 GN=Abca8b PE=1 SV=2
4	AFDB:Q8K449	0.982	0.983	0.000	1623	0.785	0.786	Q8K449.pdb.gz	ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus OX=10090 GN=Abca9 PE=1 SV=2
5	AFDB:Q8N139	0.947	0.951	0.000	1617	0.585	0.588	Q8N139.pdb.gz	ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens OX=9606 GN=ABCA6 PE=1 SV=2
6	AFDB:Q99758	0.757	0.726	5.306E-95	1704	0.273	0.261	Q99758.pdb.gz	ABCA3_HUMAN Phospholipid-transporting ATPase ABCA3 OS=Homo sapiens OX=9606 GN=ABCA3 PE=1 SV=2
7	AFDB:A0A0G2K1Q8	0.761	0.729	5.790E-94	1704	0.274	0.261	A0A0G2K1Q8.pdb.gz	ABCA3_RAT Phospholipid-transporting ATPase ABCA3 OS=Rattus norvegicus OX=10116 GN=Abca3 PE=1 SV=1
8	AFDB:E9PX95	0.744	0.703	5.526E-92	1733	0.240	0.225	E9PX95.pdb.gz	ABCAH_MOUSE ATP-binding cassette sub-family A member 17 OS=Mus musculus OX=10090 GN=Abca17 PE=1 SV=1
9	AFDB:E9PWH4	0.746	0.728	1.825E-91	1668	0.248	0.242	E9PWH4.pdb.gz	E9PWH4_MOUSE ATP-binding cassette, sub-family A (ABC1), member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
10	AFDB:Q84M24	0.771	0.673	2.176E-90	1882	0.273	0.235	Q84M24.pdb.gz	AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCA1 PE=2 SV=2
11	PDB:7w01A	0.783	0.794	1.777E-81	1598	0.271	0.275	7w01A.pdb.gz
12	PDB:7w02A	0.682	0.704	3.932E-79	1566	0.269	0.279	7w02A.pdb.gz	Cryo-EM structures of the human surfactant lipid transporter ABCA3.
13	PDB:7lkzA	0.672	0.578	3.262E-71	1920	0.243	0.205	7lkzA.pdb.gz	Molecular structures of the eukaryotic retinal importer ABCA4.
14	PDB:7tbwA	0.676	0.579	4.643E-70	1928	0.247	0.208	7tbwA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
15	PDB:7e7iA	0.680	0.559	4.229E-66	2011	0.232	0.187	7e7iA.pdb.gz
16	PDB:7e7qA	0.648	0.547	2.964E-65	1958	0.242	0.201	7e7qA.pdb.gz	Structural basis of substrate recognition and translocation by human ABCA4.
17	PDB:7tbyA	0.668	0.611	6.018E-65	1788	0.232	0.210	7tbyA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
18	PDB:7roqA	0.625	0.559	8.482E-56	1831	0.206	0.183	7roqA.pdb.gz	Structure of the Human Lipid Exporter ABCA1.
19	PDB:7m1pA	0.639	0.544	4.969E-53	1938	0.219	0.183	7m1pA.pdb.gz
20	PDB:7m1qA	0.613	0.529	1.000E-45	1911	0.211	0.179	7m1qA.pdb.gz	Cryo-EM structures of the ABCA4 importer reveal mechanisms underlying substrate binding and Stargardt disease.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94911	0.0	2338	1621	0.718	0.719	ABCA8_HUMAN ABC-type organic anion transporter ABCA8 OS=Homo sapiens OX=9606 GN=ABCA8 PE=1 SV=4
2	Q8CF82	0.0	1217	1642	0.418	0.414	ABCA5_RAT Cholesterol transporter ABCA5 OS=Rattus norvegicus OX=10116 GN=Abca5 PE=2 SV=1
3	Q8K440	0.0	2123	1620	0.658	0.659	ABC8B_MOUSE ABC-type organic anion transporter ABCA8B OS=Mus musculus OX=10090 GN=Abca8b PE=1 SV=2
4	Q8K448	0.0	1232	1642	0.422	0.418	ABCA5_MOUSE Cholesterol transporter ABCA5 OS=Mus musculus OX=10090 GN=Abca5 PE=1 SV=2
5	Q8K449	0.0	2545	1623	0.784	0.785	ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus OX=10090 GN=Abca9 PE=1 SV=2
6	Q8N139	0.0	1859	1617	0.589	0.592	ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens OX=9606 GN=ABCA6 PE=1 SV=2
7	Q8WWZ7	0.0	1236	1642	0.422	0.418	ABCA5_HUMAN Cholesterol transporter ABCA5 OS=Homo sapiens OX=9606 GN=ABCA5 PE=1 SV=2
8	Q6XBG2	3.37e-144	488	1668	0.257	0.250	Q6XBG2_MOUSE ATP-binding cassette transporter sub-family A member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
9	E9PWH4	5.95e-144	487	1668	0.257	0.250	E9PWH4_MOUSE ATP-binding cassette, sub-family A (ABC1), member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
10	Q385F7	9.34e-132	453	1738	0.245	0.229	Q385F7_TRYB2 ABC transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3950 PE=4 SV=1
11	Q8T6J2	8.16e-123	426	1662	0.254	0.248	ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum OX=44689 GN=abcA5 PE=3 SV=1
12	Q8T6J1	2.26e-115	404	1631	0.244	0.243	ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum OX=44689 GN=abcA6 PE=3 SV=1
13	Q8R420	1.07e-97	351	1704	0.179	0.170	ABCA3_MOUSE Phospholipid-transporting ATPase ABCA3 OS=Mus musculus OX=10090 GN=Abca3 PE=1 SV=3
14	A0A0G2K1Q8	5.99e-97	348	1704	0.166	0.158	ABCA3_RAT Phospholipid-transporting ATPase ABCA3 OS=Rattus norvegicus OX=10116 GN=Abca3 PE=1 SV=1
15	Q99758	1.46e-94	341	1704	0.176	0.168	ABCA3_HUMAN Phospholipid-transporting ATPase ABCA3 OS=Homo sapiens OX=9606 GN=ABCA3 PE=1 SV=2
16	Q9ESR9	1.34e-80	298	2434	0.140	0.094	ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus OX=10116 GN=Abca2 PE=1 SV=1
17	A0A087WXK5	3.99e-80	296	2466	0.139	0.091	A0A087WXK5_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens OX=9606 GN=ABCA2 PE=1 SV=1
18	Q9BZC7	4.28e-80	296	2435	0.139	0.092	ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens OX=9606 GN=ABCA2 PE=1 SV=4
19	K9J4V5	3.34e-79	293	2262	0.152	0.109	K9J4V5_PIG ATP-binding cassette sub-family A member 1 OS=Sus scrofa OX=9823 GN=ABCA1 PE=2 SV=1
20	O95477	3.13e-78	290	2261	0.148	0.107	ABCA1_HUMAN Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13175 AAA_15	5.2e+02	11.5	AAA ATPase domain
2	PF13191 AAA_16	22	16.8	AAA ATPase domain
3	PF13304 AAA_21	5.2e-16	70.9	AAA domain, putative AbiEii toxin, Type IV TA system
4	PF13401 AAA_22	34	16.1	AAA domain
5	PF13476 AAA_23	3.6	19.6	AAA domain
6	PF13481 AAA_25	4.5e+02	11.8	AAA domain
7	PF13555 AAA_29	0.11	23.6	P-loop containing region of AAA domain
8	PF13604 AAA_30	22	16.2	AAA domain
9	PF12698 ABC2_membrane_3	4.5e-38	142.9	ABC-2 family transporter protein
10	PF00005 ABC_tran	3.9e-54	194.3	ABC transporter
11	PF00006 ATP-synt_ab	2.4e+02	12.8	ATP synthase alpha/beta family, nucleotide-binding domain
12	PF13732 DUF4162	91	15.2	Domain of unknown function (DUF4162)
13	PF00350 Dynamin_N	3e+02	12.9	Dynamin family
14	PF01926 MMR_HSR1	2.3	19.8	50S ribosome-binding GTPase
15	PF03193 RsgA_GTPase	0.00038	31.9	RsgA GTPase
16	PF13558 SbcC_Walker_B	6e+02	12.1	SbcC/RAD50-like, Walker B motif
17	PF02367 TsaE	1.2e+02	14.1	Threonylcarbamoyl adenosine biosynthesis protein TsaE
18	PF06414 Zeta_toxin	2e+02	12.7	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342216

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261200	0.685	ATP-binding cassette sub-family C member 9
2	9606.ENSP00000285238	0.554	Canalicular multispecific organic anion transporter 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140359	0.998	ABC-type transporter activity
GO:0005488	0.991	binding
GO:0042910	0.990	xenobiotic transmembrane transporter activity
GO:0008559	0.981	ABC-type xenobiotic transporter activity
GO:0005548	0.886	phospholipid transporter activity
GO:0005515	0.868	protein binding
GO:0016462	0.746	pyrophosphatase activity
GO:0017111	0.742	ribonucleoside triphosphate phosphatase activity
GO:0017076	0.721	purine nucleotide binding
GO:0043168	0.709	anion binding
GO:0032555	0.691	purine ribonucleotide binding
GO:0035639	0.669	purine ribonucleoside triphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0015850	0.996	organic hydroxy compound transport
GO:0032374	0.991	regulation of cholesterol transport
GO:0010876	0.990	lipid localization
GO:0009987	0.989	cellular process
GO:0008152	0.986	metabolic process
GO:0071704	0.979	organic substance metabolic process
GO:0010874	0.975	regulation of cholesterol efflux
GO:0015918	0.966	sterol transport
GO:0030301	0.957	cholesterol transport
GO:0044237	0.924	cellular metabolic process
GO:0044238	0.923	primary metabolic process
GO:0032370	0.775	positive regulation of lipid transport
GO:0032373	0.773	positive regulation of sterol transport
GO:0032376	0.762	positive regulation of cholesterol transport
GO:0006807	0.758	nitrogen compound metabolic process
GO:0006629	0.641	lipid metabolic process
GO:1901564	0.593	organonitrogen compound metabolic process
GO:0042908	0.478	xenobiotic transport
GO:0055085	0.452	transmembrane transport
GO:0050896	0.359	response to stimulus
GO:0006793	0.349	phosphorus metabolic process
GO:0042221	0.315	response to chemical
GO:0050794	0.303	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0071944	0.996	cell periphery
GO:0012505	0.990	endomembrane system
GO:0005886	0.985	plasma membrane
GO:0005634	0.454	nucleus
GO:0070013	0.438	intracellular organelle lumen
GO:0031981	0.430	nuclear lumen
GO:0031090	0.385	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.998	Translocases.
EC:7.6.2.2	0.981	ABC-type xenobiotic transporter.
EC:3.6.1.-	0.746	In phosphorus-containing anhydrides.
RHEA:23680	0.742	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.742	nucleoside-triphosphate phosphatase.

[back to server]