StarFunc result for job id Q8IUC6

User Input

>input (712 residues)
MACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARIS
LEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQE
AVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIRTLQSNLGCLPPSSALPSGTRSLPR
PIDGVSDWSQGCSLRSTGSPASLASNLEISQSPTMPFLSLHRSPHGPSKLCDDPQASLVP
EPVPGGCQEPEEMSWPPSGEIASPPELPSSPPPGLPEVAPDATSTGLPDTPAAPETSTNY
PVECTEGSAGPQSLPLPILEPVKNPCSVKDQTPLQLSVEDTTSPNTKPCPPTPTTPETSP
PPPPPPPSSTPCSAHLTPSSLFPSSLESSSEQKFYNFVILHARADEHIALRVREKLEALG
VPDGATFCEDFQVPGRGELSCLQDAIDHSAFIILLLTSNFDCRLSLHQVNQAMMSNLTRQ
GSPDCVIPFLPLESSPAQLSSDTASLLSGLVRLDEHSQIFARKVANTFKPHRLQARKAMW
RKEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTG
APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQS
PAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IUC6	1.000	1.000	2.641E-94	712	1.000	1.000	Q8IUC6.pdb.gz	TCAM1_HUMAN TIR domain-containing adapter molecule 1 OS=Homo sapiens OX=9606 GN=TICAM1 PE=1 SV=1
2	AFDB:Q80UF7	0.348	0.339	3.223E-56	732	0.559	0.544	Q80UF7.pdb.gz	TCAM1_MOUSE TIR domain-containing adapter molecule 1 OS=Mus musculus OX=10090 GN=Ticam1 PE=1 SV=1
3	PDB:3j0aA	0.150	0.135	3.117E-3	797	0.034	0.030	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
4	PDB:7jlxA	0.121	0.416	7.254E-3	166	0.038	0.163	7jlxA.pdb.gz
5	AFDB:Q54SP4	0.133	0.066	2.224E-2	1546	0.070	0.032	Q54SP4.pdb.gz	DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum OX=44689 GN=dhkD PE=2 SV=1
6	AFDB:F8VVT9	0.148	0.098	3.842E-2	1192	0.126	0.076	F8VVT9.pdb.gz	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
7	PDB:7anwA	0.135	0.147	4.129E-2	645	0.032	0.036	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
8	PDB:2rg1A	0.135	0.397	6.786E-2	168	0.034	0.143	2rg1A.pdb.gz
9	PDB:2a5lB	0.126	0.414	7.132E-2	175	0.031	0.126	2a5lB.pdb.gz	The crystal structure of the Trp repressor binding protein WrbA from Pseudomonas aeruginosa
10	PDB:7wtlCL	0.129	0.147	7.132E-2	610	0.031	0.036	7wtlCL.pdb.gz	In vitro structural maturation of an early stage pre-40S particle coupled with U3 snoRNA release and central pseudoknot formation.
11	PDB:2q62D	0.133	0.323	1.061E-1	235	0.037	0.111	2q62D.pdb.gz
12	PDB:2nshA	0.123	0.391	1.172E-1	163	0.041	0.178	2nshA.pdb.gz	N(5)-CAIR Mutase: Role of a CO(2) Binding Site and Substrate Movement in Catalysis.
13	PDB:1x77A	0.111	0.289	1.232E-1	174	0.027	0.109	1x77A.pdb.gz	Structure determination of an FMN reductase from Pseudomonas aeruginosa PA01 using sulfur anomalous signal.
14	PDB:7cm7A	0.124	0.139	1.232E-1	620	0.034	0.039	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
15	AFDB:Q54DK4	0.059	0.042	2.415E-1	1352	0.110	0.058	Q54DK4.pdb.gz	AK1_DICDI Alpha-protein kinase 1 OS=Dictyostelium discoideum OX=44689 GN=ak1 PE=3 SV=1
16	AFDB:I3L2J8	0.082	0.060	2.803E-1	1047	0.136	0.093	I3L2J8.pdb.gz	I3L2J8_HUMAN Centrosomal protein 131 OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=1
17	AFDB:Q9I920	0.104	0.067	3.970E-1	1183	0.117	0.070	Q9I920.pdb.gz	BLM_CHICK RecQ-like DNA helicase BLM OS=Gallus gallus OX=9031 GN=BLM PE=1 SV=2
18	AFDB:Q9VEF5	0.044	0.060	4.172E-1	433	0.060	0.099	Q9VEF5.pdb.gz	Q9VEF5_DROME Inhibitor of growth protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7379 PE=1 SV=1
19	AFDB:Q8NI27	0.070	0.036	4.384E-1	1593	0.084	0.038	Q8NI27.pdb.gz	THOC2_HUMAN THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2 PE=1 SV=2
20	AFDB:Q8VY05	0.051	0.041	5.089E-1	985	0.126	0.091	Q8VY05.pdb.gz	SWI3D_ARATH SWI/SNF complex subunit SWI3D OS=Arabidopsis thaliana OX=3702 GN=SWI3D PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M0RA08	0.0	639	734	0.539	0.523	M0RA08_RAT TIR domain-containing adapter molecule 1 OS=Rattus norvegicus OX=10116 GN=Ticam1 PE=4 SV=2
2	Q80UF7	0.0	686	732	0.549	0.534	TCAM1_MOUSE TIR domain-containing adapter molecule 1 OS=Mus musculus OX=10090 GN=Ticam1 PE=1 SV=1
3	Q8IUC6	0.0	1432	712	1.000	1.000	TCAM1_HUMAN TIR domain-containing adapter molecule 1 OS=Homo sapiens OX=9606 GN=TICAM1 PE=1 SV=1
4	Q1LUQ2	5.80e-28	121	566	0.104	0.131	Q1LUQ2_DANRE TIR domain-containing adapter molecule 1 OS=Danio rerio OX=7955 GN=trif PE=2 SV=1
5	Q8BJQ4	3.28e-15	77.8	232	0.080	0.246	TCAM2_MOUSE TIR domain-containing adapter molecule 2 OS=Mus musculus OX=10090 GN=Ticam2 PE=1 SV=1
6	Q86XR7	4.45e-12	68.6	235	0.076	0.230	TCAM2_HUMAN TIR domain-containing adapter molecule 2 OS=Homo sapiens OX=9606 GN=TICAM2 PE=1 SV=1
7	A0A8I5ZUN3	0.001	44.7	35375	0.059	0.001	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
8	A2ASS6	0.012	41.6	35213	0.060	0.001	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
9	D5LMH4	4.0	33.1	1029	0.035	0.024	D5LMH4_DANRE Protein transport protein Sec24D OS=Danio rerio OX=7955 GN=sec24d PE=1 SV=1
10	F1QRB4	4.0	33.1	1030	0.035	0.024	F1QRB4_DANRE Protein transport protein Sec24D isoform X1 OS=Danio rerio OX=7955 GN=sec24d PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12721 RHIM	3.9e-05	34.2	RIP homotypic interaction motif
2	PF13676 TIR_2	10	18.2	TIR domain
3	PF17798 TRIF-NTD	6.7e-50	180.9	TRIF N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000248244

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296795	0.999	Toll-like receptor 3
2	9606.ENSP00000363089	0.999	Toll-like receptor 4
3	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
4	9606.ENSP00000259808	0.998	Receptor-interacting serine/threonine-protein kinase 1
5	9606.ENSP00000454207	0.998	TNF receptor-associated factor 3
6	9606.ENSP00000329967	0.995	Serine/threonine-protein kinase TBK1
7	9606.ENSP00000415139	0.981	TIR domain-containing adapter molecule 2
8	9606.ENSP00000471896	0.980	Interferon regulatory factor 3
9	9606.ENSP00000260010	0.967	Toll-like receptor 2
10	9606.ENSP00000351273	0.964	Caspase-8
11	9606.ENSP00000312455	0.944	CASP8 and FADD-like apoptosis regulator
12	9606.ENSP00000468032	0.943	Sterile alpha and TIR motif-containing protein 1
13	9606.ENSP00000301838	0.942	FAS-associated death domain protein
14	9606.ENSP00000380697	0.942	Interferon regulatory factor 7
15	9606.ENSP00000216274	0.938	Receptor-interacting serine/threonine-protein kinase 3
16	9606.ENSP00000358997	0.927	Interleukin-1 receptor-associated kinase 1
17	9606.ENSP00000340305	0.926	Ubiquitin-conjugating enzyme E2 variant 1
18	9606.ENSP00000353874	0.925	Toll-like receptor 9
19	9606.ENSP00000376505	0.923	TRAF family member-associated NF-kappa-B activator
20	9606.ENSP00000390651	0.923	Interleukin-1 receptor-associated kinase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	0.999	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0051716	0.995	cellular response to stimulus
GO:0007165	0.993	signal transduction
GO:0002833	0.985	positive regulation of response to biotic stimulus
GO:0048522	0.980	positive regulation of cellular process
GO:0002224	0.980	toll-like receptor signaling pathway
GO:0009966	0.977	regulation of signal transduction
GO:0010033	0.976	response to organic substance
GO:0043123	0.963	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043331	0.946	response to dsRNA
GO:0043330	0.929	response to exogenous dsRNA
GO:0019222	0.890	regulation of metabolic process
GO:0060255	0.875	regulation of macromolecule metabolic process
GO:0010468	0.855	regulation of gene expression
GO:0010604	0.853	positive regulation of macromolecule metabolic process
GO:0080090	0.780	regulation of primary metabolic process
GO:0051171	0.780	regulation of nitrogen compound metabolic process
GO:0031323	0.747	regulation of cellular metabolic process
GO:0051239	0.708	regulation of multicellular organismal process
GO:0009605	0.657	response to external stimulus
GO:0031326	0.649	regulation of cellular biosynthetic process
GO:0019219	0.644	regulation of nucleobase-containing compound metabolic process
GO:0009607	0.642	response to biotic stimulus
GO:0044419	0.631	biological process involved in interspecies interaction between organisms
GO:0006355	0.610	regulation of DNA-templated transcription
GO:0006950	0.607	response to stress
GO:0043207	0.587	response to external biotic stimulus
GO:0051707	0.579	response to other organism
GO:0051173	0.558	positive regulation of nitrogen compound metabolic process
GO:0001819	0.555	positive regulation of cytokine production
GO:0008152	0.544	metabolic process
GO:0065009	0.531	regulation of molecular function
GO:0051090	0.518	regulation of DNA-binding transcription factor activity
GO:0044237	0.504	cellular metabolic process
GO:0006807	0.488	nitrogen compound metabolic process
GO:0071310	0.484	cellular response to organic substance
GO:0051091	0.458	positive regulation of DNA-binding transcription factor activity
GO:0006952	0.427	defense response
GO:0031325	0.411	positive regulation of cellular metabolic process
GO:0071345	0.408	cellular response to cytokine stimulus
GO:0009615	0.404	response to virus
GO:0051092	0.400	positive regulation of NF-kappaB transcription factor activity
GO:0098542	0.391	defense response to other organism
GO:0051246	0.388	regulation of protein metabolic process
GO:0007166	0.376	cell surface receptor signaling pathway
GO:0006955	0.354	immune response
GO:0051247	0.338	positive regulation of protein metabolic process
GO:0031399	0.312	regulation of protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0032991	0.997	protein-containing complex
GO:0016020	0.996	membrane
GO:0030659	0.958	cytoplasmic vesicle membrane
GO:0005768	0.956	endosome
GO:0010008	0.938	endosome membrane
GO:1902494	0.707	catalytic complex
GO:0005634	0.553	nucleus
GO:0071944	0.528	cell periphery
GO:0005886	0.524	plasma membrane
GO:0070013	0.425	intracellular organelle lumen
GO:0097342	0.399	ripoptosome
GO:0031981	0.374	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]