StarFunc result for job id Q8IUD2

User Input

>input (1116 residues)
MYGSARSVGKVEPSSQSPGRSPRLPRSPRLGHRRTNSTGGSSGSSVGGGSGKTLSMENIQ
SLNAAYATSGPMYLSDHENVGSETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVAS
DTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLS
SSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTIQALQDELRIQR
DLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQ
TLNARDESIKKLLEMLQSKGLSAKATEEDHERTRRLAEAEMHVHHLESLLEQKEKENSML
REEMHRRFENAPDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNGALSTEERE
EEMKQMEVYRSHSKFMKNKVEQLKEELSSKEAQWEELKKKAAGLQAEIGQVKQELSRKDT
ELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNK
KTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKER
VKSLQADTTNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEEIDNYKKDLKDLKEK
VSLLQGDLSEKEASLLDLKEHASSLASSGLKKDSRLKTLEIALEQKKEECLKMESQLKKA
HEAALEARASPEMSDRIQHLEREITRYKDESSKAQAEVDRLLEILKEVENEKNDKDKKIA
ELERQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDNLNDSSQQLQDSLRKKDDRIE
ELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQ
SLAEKETHLTNLRAERRKHLEEVLEMKQEALLAAISEKDANIALLELSSSKKKTQEEVAA
LKREKDRLVQQLKQQTQNRMKLMADNYEDDHFKSSHSNQTNHKPSPDQIIQPLLELDQNR
SKLKLYIGHLTTLCHDRDPLILRGLTPPASYNLDDDQAAWENELQKMTRGQLQDELEKGE
RDNAELQEFANAILQQIADHCPDILEQVVNALEESS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99MI1	0.339	0.338	0.000	1120	0.971	0.968	Q99MI1.pdb.gz	RB6I2_MOUSE ELKS/Rab6-interacting/CAST family member 1 OS=Mus musculus OX=10090 GN=Erc1 PE=1 SV=1
2	AFDB:Q811U3	0.257	0.291	4.946E-84	948	0.825	0.972	Q811U3.pdb.gz	RB6I2_RAT ELKS/Rab6-interacting/CAST family member 1 OS=Rattus norvegicus OX=10116 GN=Erc1 PE=1 SV=1
3	AFDB:O15083	0.165	0.189	3.654E-62	957	0.612	0.714	O15083.pdb.gz	ERC2_HUMAN ERC protein 2 OS=Homo sapiens OX=9606 GN=ERC2 PE=1 SV=3
4	AFDB:O44490	0.132	0.173	3.707E-10	836	0.192	0.256	O44490.pdb.gz	O44490_CAEEL ELKS/RAB6-interacting/CAST family member 2 OS=Caenorhabditis elegans OX=6239 GN=elks-1 PE=1 SV=2
5	AFDB:C8VIR1	0.151	0.142	1.578E-4	1207	0.203	0.188	C8VIR1.pdb.gz	C8VIR1_EMENI Calmodulin-binding coil-coil protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03062 PE=4 SV=1
6	AFDB:Q96ST8	0.076	0.108	2.497E-4	783	0.099	0.142	Q96ST8.pdb.gz	CEP89_HUMAN Centrosomal protein of 89 kDa OS=Homo sapiens OX=9606 GN=CEP89 PE=1 SV=3
7	AFDB:Q9VTN6	0.127	0.148	3.730E-4	928	0.114	0.137	Q9VTN6.pdb.gz	Q9VTN6_DROME Twitchy OS=Drosophila melanogaster OX=7227 GN=twy PE=4 SV=1
8	AFDB:P28739	0.070	0.086	4.969E-4	770	0.069	0.100	P28739.pdb.gz	KLPA_EMENI Kinesin-like protein klpA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=klpA PE=2 SV=3
9	AFDB:Q07732	0.101	0.136	5.901E-4	790	0.102	0.144	Q07732.pdb.gz	ADY3_YEAST Accumulates dyads protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADY3 PE=1 SV=2
10	AFDB:A0A0B4JDD0	0.110	0.099	6.250E-4	1264	0.132	0.116	A0A0B4JDD0.pdb.gz	A0A0B4JDD0_DROME PFTAIRE-interacting factor 1A, isoform H OS=Drosophila melanogaster OX=7227 GN=Pif1A PE=4 SV=1
11	PDB:7z37DP1	0.068	0.267	2.956E-1	273	0.029	0.117	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
12	PDB:6sueA	0.064	0.037	6.599E-1	2292	0.030	0.014	6sueA.pdb.gz
13	PDB:7d6dA	0.080	0.204	6.599E-1	380	0.026	0.076	7d6dA.pdb.gz
14	PDB:7ajtCD	0.045	0.116	1.313	380	0.022	0.066	7ajtCD.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:5o9zH	0.040	0.099	1.560	413	0.016	0.044	5o9zH.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
16	PDB:7zxkC	0.047	0.230	1.560	166	0.019	0.127	7zxkC.pdb.gz
17	PDB:6ikoA	0.066	0.182	1.749	303	0.026	0.096	6ikoA.pdb.gz
18	PDB:3cfoA	0.043	0.052	1.853	906	0.012	0.014	3cfoA.pdb.gz	Structure of the replication complex of a POL Alpha family DNA Polymerase
19	PDB:5lkiA	0.057	0.048	2.078	1427	0.027	0.021	5lkiA.pdb.gz
20	PDB:7mq8LM	0.049	0.028	3.104	2005	0.029	0.016	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15083	0.0	1258	957	0.615	0.717	ERC2_HUMAN ERC protein 2 OS=Homo sapiens OX=9606 GN=ERC2 PE=1 SV=3
2	Q6PH08	0.0	1262	957	0.612	0.714	ERC2_MOUSE ERC protein 2 OS=Mus musculus OX=10090 GN=Erc2 PE=1 SV=2
3	Q811U3	0.0	1708	948	0.827	0.974	RB6I2_RAT ELKS/Rab6-interacting/CAST family member 1 OS=Rattus norvegicus OX=10116 GN=Erc1 PE=1 SV=1
4	Q8IUD2	0.0	2240	1116	1.000	1.000	RB6I2_HUMAN ELKS/Rab6-interacting/CAST family member 1 OS=Homo sapiens OX=9606 GN=ERC1 PE=1 SV=1
5	Q8K3M6	0.0	1248	957	0.614	0.716	ERC2_RAT ERC protein 2 OS=Rattus norvegicus OX=10116 GN=Erc2 PE=1 SV=1
6	Q99MI1	0.0	2172	1120	0.972	0.969	RB6I2_MOUSE ELKS/Rab6-interacting/CAST family member 1 OS=Mus musculus OX=10090 GN=Erc1 PE=1 SV=1
7	A0A0B4K7K9	1.09e-36	153	2238	0.073	0.037	A0A0B4K7K9_DROME Bruchpilot, isoform J OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
8	A0A0B4KF38	7.67e-36	150	1498	0.073	0.055	A0A0B4KF38_DROME Bruchpilot, isoform M OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
9	A8DY79	8.86e-36	150	1786	0.073	0.046	A8DY79_DROME Bruchpilot, isoform G OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=2
10	A1Z7V1	1.12e-35	150	1740	0.073	0.047	A1Z7V1_DROME Bruchpilot, isoform D OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
11	Q25B55	1.22e-35	150	1740	0.073	0.047	Q25B55_DROME CAST OS=Drosophila melanogaster OX=7227 GN=brp PE=2 SV=1
12	A0A0B4K6V0	8.11e-34	144	1781	0.149	0.093	A0A0B4K6V0_DROME Bruchpilot, isoform L OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
13	A0A0B4K7V8	9.31e-34	144	1707	0.149	0.097	A0A0B4K7V8_DROME Bruchpilot, isoform K OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
14	A0A0B4K843	3.35e-33	142	1397	0.073	0.059	A0A0B4K843_DROME Bruchpilot, isoform I OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
15	O44490	8.52e-32	136	836	0.125	0.167	O44490_CAEEL ELKS/RAB6-interacting/CAST family member 2 OS=Caenorhabditis elegans OX=6239 GN=elks-1 PE=1 SV=2
16	P32380	3.59e-06	53.9	944	0.115	0.136	SP110_YEAST Spindle pole body component 110 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPC110 PE=1 SV=1
17	A0A2R8Y590	2.45e-04	48.1	2122	0.091	0.048	A0A2R8Y590_HUMAN A-kinase anchoring protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=2
18	Q99996	0.001	46.2	3907	0.091	0.026	AKAP9_HUMAN A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=4
19	P50533	0.002	44.7	1203	0.093	0.086	SMC2_XENLA Structural maintenance of chromosomes protein 2 OS=Xenopus laevis OX=8355 GN=smc2 PE=1 SV=1
20	F6ZDS4	0.005	43.9	2431	0.090	0.041	TPR_MOUSE Nucleoprotein TPR OS=Mus musculus OX=10090 GN=Tpr PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13166 AAA_13	10	16.4	AAA domain
2	PF08614 ATG16	2.1	20.0	Autophagy protein 16 (ATG16)
3	PF10174 Cast	0	1176.6	RIM-binding protein of the cytomatrix active zone
4	PF19220 Crescentin	2	19.0	Crescentin protein
5	PF17588 DUF5486	2.2e+02	13.1	Family of unknown function (DUF5486)
6	PF06818 Fez1	41	16.0	Fez1
7	PF13851 GAS	2.2	19.2	Growth-arrest specific micro-tubule binding
8	PF16808 PKcGMP_CC	85	14.3	Coiled-coil N-terminus of cGMP-dependent protein kinase
9	PF09457 RBD-FIP	1.2e-11	55.6	FIP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000468263

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483825	0.998	NF-kappa-B essential modulator
2	9606.ENSP00000311449	0.991	Ras-related protein Rab-6A
3	9606.ENSP00000430684	0.988	Inhibitor of nuclear factor kappa-B kinase subunit beta
4	9606.ENSP00000296452	0.984	Protein bassoon
5	9606.ENSP00000405405	0.981	Pleckstrin homology-like domain family B member 2
6	9606.ENSP00000428417	0.974	Regulating synaptic membrane exocytosis protein 1
7	9606.ENSP00000253925	0.973	Liprin-alpha-1
8	9606.ENSP00000359424	0.966	Inhibitor of nuclear factor kappa-B kinase subunit alpha
9	9606.ENSP00000216797	0.961	NF-kappa-B inhibitor alpha
10	9606.ENSP00000356426	0.946	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
11	9606.ENSP00000226574	0.932	Nuclear factor NF-kappa-B p105 subunit
12	9606.ENSP00000358335	0.930	Mitogen-activated protein kinase kinase kinase 7
13	9606.ENSP00000367756	0.930	Protein unc-13 homolog B
14	9606.ENSP00000384273	0.929	Transcription factor p65
15	9606.ENSP00000335614	0.925	Liprin-alpha-3
16	9606.ENSP00000433623	0.924	TNF receptor-associated factor 6
17	9606.ENSP00000216160	0.919	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
18	9606.ENSP00000354927	0.912	Mitogen-activated protein kinase kinase kinase 3
19	9606.ENSP00000358997	0.906	Interleukin-1 receptor-associated kinase 1
20	9606.ENSP00000295797	0.903	Protein kinase C iota type

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.832	enzyme binding
GO:0098918	0.798	structural constituent of synapse
GO:0051020	0.739	GTPase binding
GO:0031267	0.715	small GTPase binding
GO:0098882	0.421	structural constituent of presynaptic active zone
GO:0019904	0.328	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0051641	0.966	cellular localization
GO:0006810	0.957	transport
GO:0023052	0.956	signaling
GO:0007154	0.938	cell communication
GO:0071840	0.888	cellular component organization or biogenesis
GO:0007267	0.870	cell-cell signaling
GO:0016192	0.830	vesicle-mediated transport
GO:0016043	0.824	cellular component organization
GO:0051649	0.812	establishment of localization in cell
GO:0006836	0.771	neurotransmitter transport
GO:0065008	0.736	regulation of biological quality
GO:0001505	0.716	regulation of neurotransmitter levels
GO:0099536	0.601	synaptic signaling
GO:0051128	0.594	regulation of cellular component organization
GO:0071704	0.574	organic substance metabolic process
GO:0044238	0.564	primary metabolic process
GO:0050896	0.562	response to stimulus
GO:0032940	0.514	secretion by cell
GO:0006807	0.499	nitrogen compound metabolic process
GO:0030003	0.496	intracellular monoatomic cation homeostasis
GO:0098771	0.495	inorganic ion homeostasis
GO:0019222	0.481	regulation of metabolic process
GO:0051716	0.456	cellular response to stimulus
GO:0098916	0.435	anterograde trans-synaptic signaling
GO:0060255	0.426	regulation of macromolecule metabolic process
GO:0031323	0.426	regulation of cellular metabolic process
GO:0080090	0.425	regulation of primary metabolic process
GO:0051171	0.425	regulation of nitrogen compound metabolic process
GO:0007268	0.414	chemical synaptic transmission
GO:0045055	0.414	regulated exocytosis
GO:0044237	0.409	cellular metabolic process
GO:0048518	0.383	positive regulation of biological process
GO:0010468	0.381	regulation of gene expression
GO:0099504	0.378	synaptic vesicle cycle
GO:0016079	0.361	synaptic vesicle exocytosis
GO:0043170	0.341	macromolecule metabolic process
GO:0032879	0.340	regulation of localization
GO:0055074	0.327	calcium ion homeostasis
GO:0051049	0.324	regulation of transport
GO:0007165	0.317	signal transduction
GO:0048522	0.303	positive regulation of cellular process
GO:0033043	0.302	regulation of organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0098793	0.999	presynapse
GO:0043226	0.992	organelle
GO:0071944	0.989	cell periphery
GO:0016020	0.986	membrane
GO:0005829	0.983	cytosol
GO:0043229	0.982	intracellular organelle
GO:0043227	0.977	membrane-bounded organelle
GO:0005886	0.951	plasma membrane
GO:0043231	0.940	intracellular membrane-bounded organelle
GO:0012505	0.905	endomembrane system
GO:0032991	0.859	protein-containing complex
GO:0031982	0.807	vesicle
GO:0097708	0.701	intracellular vesicle
GO:0031410	0.663	cytoplasmic vesicle
GO:0048786	0.590	presynaptic active zone
GO:0043232	0.476	intracellular non-membrane-bounded organelle
GO:0099568	0.402	cytoplasmic region
GO:0098978	0.320	glutamatergic synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]