StarFunc result for job id Q8IUD6

User Input

>input (432 residues)
MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACP
TCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRP
ELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKAFSSGVDL
SMASPKLVTSDTAAGKIRDILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPL
PDQSHPALRRASRFAQWAIHPTFNLKSLSCSLEVSKDSRTVTVSHRPQPYRWSCERFSTS
QVLCSQALSSGKHYWEVDTRNCSHWAVGVASWEMSRDQVLGRTMDSCCVEWKGTSQLSAW
HMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLH
PGNYLIIKQVKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IUD6	1.000	1.000	1.885E-82	432	1.000	1.000	Q8IUD6.pdb.gz	RN135_HUMAN E3 ubiquitin-protein ligase RNF135 OS=Homo sapiens OX=9606 GN=RNF135 PE=1 SV=2
2	AFDB:Q6QI24	0.432	0.315	1.493E-51	596	0.609	0.441	Q6QI24.pdb.gz	Q6QI24_RAT LRRGT00184 OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=2 SV=1
3	AFDB:Q9CWS1	0.426	0.441	1.118E-50	417	0.569	0.590	Q9CWS1.pdb.gz	RN135_MOUSE E3 ubiquitin-protein ligase RNF135 OS=Mus musculus OX=10090 GN=Rnf135 PE=2 SV=1
4	AFDB:A0A0R4IKI3	0.392	0.262	1.339E-25	654	0.278	0.183	A0A0R4IKI3.pdb.gz
5	AFDB:Q6PJ69	0.388	0.326	2.122E-25	517	0.257	0.215	Q6PJ69.pdb.gz	TRI65_HUMAN E3 ubiquitin-protein ligase TRIM65 OS=Homo sapiens OX=9606 GN=TRIM65 PE=1 SV=3
6	AFDB:A2BFT4	0.385	0.294	3.355E-24	573	0.259	0.195	A2BFT4.pdb.gz
7	AFDB:Q14258	0.403	0.278	1.123E-23	630	0.257	0.176	Q14258.pdb.gz	TRI25_HUMAN E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2
8	AFDB:F1QYX5	0.389	0.291	1.779E-23	582	0.243	0.180	F1QYX5.pdb.gz	F1QYX5_DANRE Bloodthirsty-related gene family, member 1 OS=Danio rerio OX=7955 GN=btr01 PE=4 SV=2
9	AFDB:Q6AZZ1	0.394	0.352	2.114E-23	485	0.220	0.196	Q6AZZ1.pdb.gz	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
10	AFDB:Q8C0E3	0.382	0.261	2.661E-23	641	0.262	0.176	Q8C0E3.pdb.gz	TRI47_MOUSE E3 ubiquitin-protein ligase TRIM47 OS=Mus musculus OX=10090 GN=Trim47 PE=1 SV=2
11	PDB:7y4sA	0.372	0.464	1.133E-15	343	0.150	0.190	7y4sA.pdb.gz
12	PDB:4b3nA	0.337	0.265	1.066E-13	557	0.093	0.072	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:7ccbA	0.295	0.725	1.883E-10	164	0.079	0.207	7ccbA.pdb.gz
14	PDB:7nscA	0.319	0.482	6.264E-7	276	0.056	0.087	7nscA.pdb.gz
15	PDB:6venO	0.275	0.370	1.049E-5	315	0.079	0.108	6venO.pdb.gz	Structural basis for COMPASS recognition of an H2B-ubiquitinated nucleosome.
16	PDB:7nsba	0.268	0.208	2.633E-5	568	0.056	0.042	7nsba.pdb.gz
17	PDB:7tzcA	0.231	0.025	3.938E-5	4404	0.060	0.006	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
18	PDB:7ua3A	0.226	0.024	4.171E-5	4443	0.058	0.006	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
19	PDB:7m6aA	0.232	0.025	4.957E-5	4306	0.060	0.006	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
20	PDB:6swy1	0.265	0.217	5.890E-5	542	0.081	0.065	6swy1.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IUD6	0.0	885	432	1.000	1.000	RN135_HUMAN E3 ubiquitin-protein ligase RNF135 OS=Homo sapiens OX=9606 GN=RNF135 PE=1 SV=2
2	Q6QI24	1.76e-174	503	596	0.606	0.440	Q6QI24_RAT LRRGT00184 OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=2 SV=1
3	A0A0H2UHC7	2.71e-174	502	591	0.606	0.443	A0A0H2UHC7_RAT Ras homolog family member T1 OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=1 SV=1
4	Q9CWS1	2.25e-165	473	417	0.583	0.604	RN135_MOUSE E3 ubiquitin-protein ligase RNF135 OS=Mus musculus OX=10090 GN=Rnf135 PE=2 SV=1
5	A0A2R8QTG3	2.84e-22	101	645	0.127	0.085	A0A2R8QTG3_DANRE E3 ubiquitin/ISG15 ligase TRIM25 isoform X1 OS=Danio rerio OX=7955 GN=zgc:55773 PE=1 SV=1
6	Q7ZVQ7	3.02e-22	101	654	0.127	0.084	Q7ZVQ7_DANRE E3 ubiquitin/ISG15 ligase TRIM25 OS=Danio rerio OX=7955 GN=zgc:55773 PE=1 SV=1
7	Q61510	3.43e-20	95.5	634	0.125	0.085	TRI25_MOUSE E3 ubiquitin/ISG15 ligase TRIM25 OS=Mus musculus OX=10090 GN=Trim25 PE=1 SV=2
8	Q14258	7.30e-20	94.4	630	0.125	0.086	TRI25_HUMAN E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2
9	Q6P7B3	2.19e-19	92.8	643	0.123	0.082	Q6P7B3_RAT Tripartite motif-containing 25 OS=Rattus norvegicus OX=10116 GN=Trim25 PE=2 SV=1
10	D4A9N5	2.74e-19	92.8	643	0.123	0.082	D4A9N5_RAT Tripartite motif-containing 25 OS=Rattus norvegicus OX=10116 GN=Trim25 PE=1 SV=3
11	Q80V85	6.43e-19	90.9	475	0.259	0.236	TRI62_MOUSE E3 ubiquitin-protein ligase TRIM62 OS=Mus musculus OX=10090 GN=Trim62 PE=2 SV=1
12	Q9BVG3	1.81e-18	89.7	475	0.257	0.234	TRI62_HUMAN E3 ubiquitin-protein ligase TRIM62 OS=Homo sapiens OX=9606 GN=TRIM62 PE=1 SV=1
13	P19474	4.17e-18	88.6	475	0.264	0.240	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
14	Q62191	7.59e-18	87.8	470	0.262	0.240	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
15	Q3U7K7	1.57e-17	86.7	462	0.259	0.242	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
16	Q495X7	2.87e-16	82.8	471	0.278	0.255	TRI60_HUMAN Tripartite motif-containing protein 60 OS=Homo sapiens OX=9606 GN=TRIM60 PE=1 SV=2
17	Q1XH17	1.49e-15	80.9	477	0.266	0.241	TRI72_MOUSE Tripartite motif-containing protein 72 OS=Mus musculus OX=10090 GN=Trim72 PE=1 SV=1
18	Q3UWZ0	1.92e-14	77.4	467	0.250	0.231	TRI75_MOUSE Tripartite motif-containing protein 75 OS=Mus musculus OX=10090 GN=Trim75 PE=1 SV=1
19	Q9C035	1.58e-13	74.7	493	0.264	0.231	TRIM5_HUMAN Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1
20	Q6ZMU5	5.12e-13	72.8	477	0.278	0.252	TRI72_HUMAN Tripartite motif-containing protein 72 OS=Homo sapiens OX=9606 GN=TRIM72 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	1.9e+02	13.4	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF14447 Prok-RING_4	6.8	18.0	Prokaryotic RING finger family 4
3	PF13765 PRY	0.1	23.5	SPRY-associated domain
4	PF00622 SPRY	1.8e-06	39.4	SPRY domain
5	PF00097 zf-C3HC4	3.4e-05	34.9	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	0.0029	28.7	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	0.00024	32.2	Zinc finger, C3HC4 type (RING finger)
8	PF15227 zf-C3HC4_4	1.7e-07	42.6	zinc finger of C3HC4-type, RING
9	PF02891 zf-MIZ	7.8e+02	11.3	MIZ/SP-RING zinc finger
10	PF16685 zf-RING_10	15	17.1	zinc RING finger of MSL2
11	PF13639 zf-RING_2	0.0034	29.0	Ring finger domain
12	PF14634 zf-RING_5	0.018	26.3	zinc-RING finger domain
13	PF13445 zf-RING_UBOX	0.00052	31.3	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328340

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369213	0.988	Probable ATP-dependent RNA helicase DDX58
2	9606.ENSP00000156084	0.939	OTU domain-containing protein 5
3	9606.ENSP00000387334	0.931	NLR family member X1
4	9606.ENSP00000374552	0.913	E3 ubiquitin-protein ligase RNF216
5	9606.ENSP00000401980	0.900	Mitochondrial antiviral-signaling protein
6	9606.ENSP00000263642	0.848	Interferon-induced helicase C domain-containing protein 1
7	9606.ENSP00000329967	0.841	Serine/threonine-protein kinase TBK1
8	9606.ENSP00000471896	0.819	Interferon regulatory factor 3
9	9606.ENSP00000454207	0.778	TNF receptor-associated factor 3
10	9606.ENSP00000444743	0.764	Protein phosphatase Slingshot homolog 2
11	9606.ENSP00000380697	0.733	Interferon regulatory factor 7
12	9606.ENSP00000333779	0.729	Protein EVI2B
13	9606.ENSP00000433623	0.725	TNF receptor-associated factor 6
14	9606.ENSP00000483825	0.725	NF-kappa-B essential modulator
15	9606.ENSP00000376505	0.724	TRAF family member-associated NF-kappa-B activator
16	9606.ENSP00000247270	0.720	Protein EVI2A
17	9606.ENSP00000480499	0.719	E3 ubiquitin-protein ligase Itchy homolog
18	9606.ENSP00000217740	0.710	E3 ubiquitin-protein ligase RNF125
19	9606.ENSP00000359424	0.710	Inhibitor of nuclear factor kappa-B kinase subunit alpha
20	9606.ENSP00000216797	0.704	NF-kappa-B inhibitor alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	0.999	ubiquitin-protein transferase activity
GO:0042802	0.959	identical protein binding
GO:0061630	0.955	ubiquitin protein ligase activity
GO:0005102	0.906	signaling receptor binding
GO:0043021	0.758	ribonucleoprotein complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0009987	0.985	cellular process
GO:0050794	0.984	regulation of cellular process
GO:0051716	0.977	cellular response to stimulus
GO:0060255	0.965	regulation of macromolecule metabolic process
GO:0023052	0.955	signaling
GO:0007154	0.955	cell communication
GO:0071704	0.946	organic substance metabolic process
GO:0048518	0.942	positive regulation of biological process
GO:0044238	0.934	primary metabolic process
GO:0048583	0.933	regulation of response to stimulus
GO:0010468	0.920	regulation of gene expression
GO:0007165	0.918	signal transduction
GO:0045088	0.911	regulation of innate immune response
GO:0032479	0.909	regulation of type I interferon production
GO:0009615	0.908	response to virus
GO:0045089	0.899	positive regulation of innate immune response
GO:0002253	0.892	activation of immune response
GO:0043170	0.891	macromolecule metabolic process
GO:0006807	0.888	nitrogen compound metabolic process
GO:0006950	0.873	response to stress
GO:0030522	0.869	intracellular receptor signaling pathway
GO:0002753	0.864	cytosolic pattern recognition receptor signaling pathway
GO:0036211	0.845	protein modification process
GO:0045087	0.843	innate immune response
GO:0051607	0.841	defense response to virus
GO:0000209	0.817	protein polyubiquitination
GO:0001819	0.756	positive regulation of cytokine production
GO:0140374	0.621	antiviral innate immune response
GO:0048522	0.504	positive regulation of cellular process
GO:0032648	0.426	regulation of interferon-beta production
GO:0032481	0.424	positive regulation of type I interferon production
GO:0023051	0.399	regulation of signaling
GO:0010646	0.399	regulation of cell communication
GO:0009966	0.366	regulation of signal transduction
GO:0048519	0.349	negative regulation of biological process
GO:0031323	0.322	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0032991	0.989	protein-containing complex
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0005829	0.986	cytosol
GO:0043231	0.968	intracellular membrane-bounded organelle
GO:0005634	0.930	nucleus
GO:0099080	0.575	supramolecular complex
GO:0070013	0.546	intracellular organelle lumen
GO:0031981	0.544	nuclear lumen
GO:0005654	0.528	nucleoplasm
GO:0035770	0.388	ribonucleoprotein granule
GO:0036464	0.384	cytoplasmic ribonucleoprotein granule
GO:0010494	0.371	cytoplasmic stress granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]