StarFunc result for job id Q8IUG5

User Input

>input (2567 residues)
MAISSRLALWEQKIREEDKSPPPSSPPPLFSVIPGGFIKQLVRGTEKEAKEARQRKQLAV
ASPEREIPEISISQPNSKSSSGTRSGSQQISQDDQSSSPGSSDILGKESEGSRSPDPEQM
TSINGEKAQELGSSATPTKKTVPFKRGVRRGDVLLMVAKLDPDSAKPEKTHPHDAPPCKT
SPPATDTGKEKKGETSRTPCGSQASTEILAPKAEKTRTGGLGDPGQGTVALKKGEEGQSI
VGKGLGTPKTTELKEAEPQGKDRQGTRPQAQGPGEGVRPGKAEKEGAEPTNTVEKGNVSK
DVGSEGKHVRPQIPGRKWGGFLGRRSKWDGPQNKKDKEGVLLSKAEKTGEPQTQMEKTSQ
VQGELGDDLRMGEKAGELRSTTGKAGESWDKKEKMGQPQGKSGNAGEARSQTEKGCEAPK
EVSTMVESPAAPGKGGWPGSRGQEAEEPCSRAGDGAGALETELEGPSQPALEKDAERPRI
RKENQDGPAPQEEGKGGQSRDSDQAPEDRWYEAEKVWLAQKDGFTLATVLKPDEGTADLP
AGRVRLWIDADKTITEVDEEHVHRANPPELDQVEDLASLISVNESSVLNTLLQRYKAQLL
HTCTGPDLIVLQPRGPSVPSAGKVPKGRRDGLPAHIGSMAQRAYWALLNQRRDQSIVALG
WSGAGKTTCCEQVLEHLVGMAGSVDGRVSVEKIRATFTVLRAFGSVSMAHSRSATRFSMV
MSLDFNATGRITAAQLQTMLLEKSRVARQPEGESNFLVFSQMLAGLDLDLRTELNLHQMA
DSSSFGMGVWSKPEDKQKAAAAFAQLQGAMEMLGISESEQRAVWRVLAAIYHLGAAGACK
VGRKQFMRFEWANYAAEALGCEYEELNTATFKHHLRQIIQQMTFGPSRWGLEDEETSSGL
KMTGVDCVEGMASGLYQELFAAVVSLINRSFSSHHLSMASIMVVDSPGFQNPRHQGKDRA
ATFEELCHNYAHERLQLLFYQRTFVSTLQRYQEEGVPVQFDLPDPSPGTTVAVVDQNPSQ
VRLPAGGGAQDARGLFWVLDEEVHVEGSSDSVVLERLCAAFEKKGAGTEGSSALRTCEQP
LQCEIFHQLGWDPVRYDLTGWLHRAKPNLSALDAPQVLHQSKREELRSLFQARAKLPPVC
RAVAGLEGTSQQALQRSRMVRRTFASSLAAVRRKAPCSQIKLQMDALTSMIKRSRLHFIH
CLVPNPVVESRSGQESPPPPQPGRDKPGAGGPLALDIPALRVQLAGFHILEALRLHRTGY
ADHMGLTRFRRQFQVLDAPLLKKLMSTSEGIDERKAVEELLETLDLEKKAVAVGHSQVFL
KAGVISRLEKQREKLVSQSIVLFQAACKGFLSRQEFKKLKIRRLAAQCIQKNVAVFLAVK
DWPWWQLLGSLQPLLSATIGTEQLRAKEEELTTLRRKLEKSEKLRNELRQNTDLLESKIA
DLTSDLADERFKGDVACQVLESERAERLQAFREVQELKSKHEQVQKKLGDVNKQLEEAQQ
KIQLNDLERNPTGGADEWQMRFDCAQMENEFLRKRLQQCEERLDSELTARKELEQKLGEL
QSAYDGAKKMAHQLKRKCHHLTCDLEDTCVLLENQQSRNHELEKKQKKFDLQLAQALGES
VFEKGLREKVTQENTSVRWELGQLQQQLKQKEQEASQLKQQVEMLQDHKRELLGSPSLGE
NCVAGLKERLWKLESSALEQQKIQSQQENTIKQLEQLRQRFELEIERMKQMHQKDREDQE
EELEDVRQSCQKRLHQLEMQLEQEYEEKQMVLHEKQDLEGLIGTLCDQIGHRDFDVEKRL
RRDLRRTHALLSDVQLLLGTMEDGKTSVSKEELEKVHSQLEQSEAKCEEALKTQKVLTAD
LESMHSELENMTRNKSLVDEQLYRLQFEKADLLKRIDEDQDDLNELMQKHKDLIAQSAAD
IGQIQELQLQLEEAKKEKHKLQEQLQVAQMRIEYLEQSTVDRAIVSRQEAVICDLENKTE
FQKVQIKRFEVLVIRLRDSLIKMGEELSQAATSESQQRESSQYYQRRLEELKADMEELVQ
REAEASRRCMELEKYVEELAAVRQTLQTDLETSIRRIADLQAALEEVASSDSDTESVQTA
VDCGSSGRKEMDNVSILSSQPEGSLQSWLSCTLSLATDTMRTPSRQSATSSRILSPRINE
EAGDTERTQSALALSRARSTNVHSKTSGDKPVSPHFVRRQKYCHFGDGEVLAVQRKSTER
LEPASSPLASRSTNTSPLSREKLPSPSAALSEFVEGLRRKRAQRGQGSTLGLEDWPTLPI
YQTTGASTLRRGRAGSDEGNLSLRVGAKSPLEIEGAAGGLLRSTSLKCISSDGVGGTTLL
PEKSKTQFSSCESLLESRPSMGRKLSSPTTPRDMLLSPTLRPRRRCLESSVDDAGCPDLG
KEPLVFQNRQFAHLMEEPLGSDPFSWKLPSLDYERKTKVDFDDFLPAIRKPQTPTSLAGS
AKGGQDGSQRSSIHFETEEANRSFLSGIKTILKKSPEPKEDPAHLSDSSSSSGSIVSFKS
ADSIKSRPGIPRLAGDGGERTSPERREPGTGRKDDDVASIMKKYLQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7FE29	0.372	0.373	0.000	2557	0.347	0.348	E7FE29.pdb.gz
2	AFDB:E9PV66	0.486	0.480	0.000	2605	0.743	0.732	E9PV66.pdb.gz	E9PV66_MOUSE Myosin XVIIIb OS=Mus musculus OX=10090 GN=Myo18b PE=1 SV=1
3	AFDB:Q8IUG5	1.000	1.000	0.000	2567	1.000	1.000	Q8IUG5.pdb.gz	MY18B_HUMAN Unconventional myosin-XVIIIb OS=Homo sapiens OX=9606 GN=MYO18B PE=1 SV=2
4	AFDB:Q8INC3	0.370	0.428	2.948E-90	2194	0.240	0.281	Q8INC3.pdb.gz	Q8INC3_DROME Myosin heavy chain-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=2
5	PDB:4pa0A	0.223	0.546	5.167E-40	974	0.076	0.201	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
6	PDB:4anjA	0.245	0.608	2.378E-39	995	0.067	0.172	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
7	PDB:4pa0B	0.222	0.579	3.440E-38	920	0.072	0.202	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
8	PDB:6ycxB	0.251	0.736	1.440E-37	817	0.065	0.206	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
9	PDB:7mf3B	0.253	0.680	2.320E-37	896	0.095	0.271	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
10	PDB:4p7hB	0.225	0.569	6.544E-36	952	0.072	0.195	4p7hB.pdb.gz
11	PDB:5tbyA	0.242	0.597	3.433E-34	954	0.097	0.262	5tbyA.pdb.gz
12	AFDB:Q5DU14	0.242	0.320	9.280E-29	1919	0.112	0.150	Q5DU14.pdb.gz	MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus OX=10090 GN=Myo16 PE=1 SV=2
13	AFDB:Q4GYI3	0.042	0.089	1.020E-5	912	0.057	0.160	Q4GYI3.pdb.gz	Q4GYI3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3940 PE=4 SV=1
14	AFDB:P85120	0.055	0.066	8.220E-4	2058	0.108	0.135	P85120.pdb.gz	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
15	AFDB:A0A0R4IZ84	0.039	0.054	4.366E-3	1544	0.076	0.126	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
16	AFDB:Q9P219	0.044	0.054	1.308E-2	2028	0.097	0.123	Q9P219.pdb.gz	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
17	AFDB:A4GSN8	0.043	0.049	1.661E-2	2093	0.100	0.123	A4GSN8.pdb.gz	NUA_ARATH Nuclear-pore anchor OS=Arabidopsis thaliana OX=3702 GN=NUA PE=1 SV=1
18	PDB:7r5jK0	0.045	0.079	3.843E-1	1086	0.032	0.075	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:1fa9A	0.044	0.078	4.227E-1	834	0.033	0.101	1fa9A.pdb.gz	Activation of human liver glycogen phosphorylase by alteration of the secondary structure and packing of the catalytic core.
20	PDB:3ajwA	0.042	0.503	5.366E-1	134	0.009	0.172	3ajwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4J7R2	0.0	1273	2454	0.271	0.284	A0A0R4J7R2_DANRE Myosin XVIIIAa OS=Danio rerio OX=7955 GN=myo18aa PE=3 SV=1
2	B7ZNF7	0.0	2138	1357	0.412	0.780	B7ZNF7_MOUSE Myo18b protein (Fragment) OS=Mus musculus OX=10090 GN=Myo18b PE=2 SV=1
3	E9PV66	0.0	3556	2605	0.743	0.732	E9PV66_MOUSE Myosin XVIIIb OS=Mus musculus OX=10090 GN=Myo18b PE=1 SV=1
4	Q0KI66	0.0	755	1923	0.209	0.279	Q0KI66_DROME Myosin heavy chain-like, isoform F OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=1
5	Q0KI67	0.0	758	2160	0.208	0.247	Q0KI67_DROME Myosin heavy chain-like, isoform G OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=1
6	Q7K523	0.0	756	2028	0.208	0.263	Q7K523_DROME GH15471p OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=2 SV=1
7	Q8INC3	0.0	759	2194	0.208	0.243	Q8INC3_DROME Myosin heavy chain-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=2
8	Q8IUG5	0.0	5234	2567	1.000	1.000	MY18B_HUMAN Unconventional myosin-XVIIIb OS=Homo sapiens OX=9606 GN=MYO18B PE=1 SV=2
9	Q92614	0.0	1337	2054	0.293	0.366	MY18A_HUMAN Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A PE=1 SV=3
10	Q9D4I1	0.0	1256	745	0.235	0.809	Q9D4I1_MOUSE Myosin motor domain-containing protein OS=Mus musculus OX=10090 GN=Myo18b PE=2 SV=1
11	Q9JMH9	0.0	1311	2050	0.288	0.360	MY18A_MOUSE Unconventional myosin-XVIIIa OS=Mus musculus OX=10090 GN=Myo18a PE=1 SV=2
12	Q9VEZ0	0.0	758	2148	0.208	0.249	Q9VEZ0_DROME Myosin heavy chain-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=3
13	P10587	1.12e-92	339	1979	0.161	0.209	MYH11_CHICK Myosin-11 OS=Gallus gallus OX=9031 GN=MYH11 PE=1 SV=4
14	P35748	1.46e-92	338	1972	0.161	0.210	MYH11_RABIT Myosin-11 OS=Oryctolagus cuniculus OX=9986 GN=MYH11 PE=2 SV=2
15	P35749	4.04e-91	334	1972	0.161	0.209	MYH11_HUMAN Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3
16	A6QLN6	4.25e-91	333	1972	0.161	0.209	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
17	P35580	4.44e-89	327	1976	0.160	0.208	MYH10_HUMAN Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3
18	Q61879	2.59e-88	325	1976	0.159	0.206	MYH10_MOUSE Myosin-10 OS=Mus musculus OX=10090 GN=Myh10 PE=1 SV=2
19	Q9JLT0	1.39e-87	322	1976	0.158	0.205	MYH10_RAT Myosin-10 OS=Rattus norvegicus OX=10116 GN=Myh10 PE=1 SV=1
20	G3V9Y1	2.44e-87	322	1986	0.159	0.205	G3V9Y1_RAT Myosin heavy chain 10 OS=Rattus norvegicus OX=10116 GN=Myh10 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	44	15.8	AAA domain
2	PF19068 DUF5764	2.1e+02	13.3	Family of unknown function (DUF5764)
3	PF00612 IQ	14	16.8	IQ calmodulin-binding motif
4	PF00063 Myosin_head	2.8e-75	265.6	Myosin head (motor domain)
5	PF01576 Myosin_tail_1	0.00067	29.3	Myosin tail

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334563

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344871	0.918	Unconventional myosin-If
2	9606.ENSP00000348349	0.918	Unconventional myosin-IXa
3	9606.ENSP00000352834	0.911	Unconventional myosin-Ic
4	9606.ENSP00000248933	0.909	Seizure 6-like protein
5	9606.ENSP00000358994	0.906	Unconventional myosin-VI
6	9606.ENSP00000317578	0.905	Beta-adrenergic receptor kinase 2
7	9606.ENSP00000291231	0.798	Olfactory receptor 3A3
8	9606.ENSP00000446955	0.788	Myosin light polypeptide 6
9	9606.ENSP00000450385	0.788	Myosin light chain 6B
10	9606.ENSP00000319197	0.776	Olfactory receptor 4K17
11	9606.ENSP00000386180	0.746	Olfactory receptor 3A2
12	9606.ENSP00000477310	0.724	Dynein light chain 2, cytoplasmic
13	9606.ENSP00000391788	0.720	Interactor of HORMAD1 protein 1
14	9606.ENSP00000385545	0.690	Kinesin-like protein KIF26B
15	9606.ENSP00000361883	0.655	Adenylyl cyclase-associated protein 1
16	9606.ENSP00000352424	0.644	TGFB1-induced anti-apoptotic factor 1
17	9606.ENSP00000401437	0.628	LIM domain-binding protein 3
18	9606.ENSP00000310572	0.615	26S proteasome regulatory subunit 8
19	9606.ENSP00000263849	0.607	Zinc finger C2HC-type containing 1A
20	9606.ENSP00000366826	0.592	Ankyrin repeat domain-containing protein 20A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	0.999	actin binding
GO:0044877	0.965	protein-containing complex binding
GO:0051015	0.964	actin filament binding
GO:0003774	0.850	cytoskeletal motor activity
GO:0000146	0.571	microfilament motor activity
GO:0043167	0.440	ion binding
GO:0043168	0.432	anion binding
GO:1901363	0.428	heterocyclic compound binding
GO:0097159	0.428	organic cyclic compound binding
GO:0005524	0.424	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0032501	0.951	multicellular organismal process
GO:0048856	0.927	anatomical structure development
GO:0009888	0.889	tissue development
GO:0007275	0.872	multicellular organism development
GO:0061061	0.854	muscle structure development
GO:0048468	0.814	cell development
GO:0048513	0.792	animal organ development
GO:0060537	0.772	muscle tissue development
GO:0065007	0.752	biological regulation
GO:0009653	0.748	anatomical structure morphogenesis
GO:0050789	0.689	regulation of biological process
GO:0048731	0.687	system development
GO:0014706	0.553	striated muscle tissue development
GO:0051146	0.492	striated muscle cell differentiation
GO:0007507	0.454	heart development
GO:0050794	0.452	regulation of cellular process
GO:0071840	0.447	cellular component organization or biogenesis
GO:0016043	0.409	cellular component organization
GO:0048738	0.393	cardiac muscle tissue development
GO:0035051	0.384	cardiocyte differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015629	1.000	actin cytoskeleton
GO:0032991	0.999	protein-containing complex
GO:0005737	0.973	cytoplasm
GO:0099512	0.852	supramolecular fiber
GO:0016459	0.728	myosin complex
GO:0016461	0.700	unconventional myosin complex
GO:0043227	0.651	membrane-bounded organelle
GO:0043292	0.642	contractile fiber
GO:0030016	0.584	myofibril
GO:0005829	0.378	cytosol
GO:0016020	0.351	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.571	myosin ATPase.

[back to server]