StarFunc result for job id Q8IUH4

User Input

>input (622 residues)
MEGPGLGSQCRNHSHGPHPPGFGRYGICAHENKELANAREALPLIEDSSNCDIVKATQYG
IFERCKELVEAGYDVRQPDKENVSLLHWAAINNRLDLVKFYISKGAVVDQLGGDLNSTPL
HWAIRQGHLPMVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV
NGQTPLMLSAHKVIGPEPTGFLLKFNPSLNVVDKIHQNTPLHWAVAAGNVNAVDKLLEAG
SSLDIQNVKGETPLDMALQNKNQLIIHMLKTEAKMRANQKFRLWRWLQKCELFLLLMLSV
ITMWAIGYILDFNSDSWLLKGCLLVTLFFLTSLFPRFLVGYKNLVYLPTAFLLSSVFWIF
MTWFILFFPDLAGAPFYFSFIFSIVAFLYFFYKTWATDPGFTKASEEEKKVNIITLAETG
SLDFRTFCTSCLIRKPLRSLHCHVCNCCVARYDQHCLWTGRCIGFGNHHYYIFFLFFLSM
VCGWIIYGSFIYLSSHCATTFKEDGLWTYLNQIVACSPWVLYILMLATFHFSWSTFLLLN
QLFQIAFLGLTSHERISLQKQSKHMKQTLSLRKTPYNLGFMQNLADFFQCGCFGLVKPCV
VDWTSQYTMVFHPAREKVLRSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IUH4	1.000	1.000	3.982E-89	622	1.000	1.000	Q8IUH4.pdb.gz	ZDH13_HUMAN Palmitoyltransferase ZDHHC13 OS=Homo sapiens OX=9606 GN=ZDHHC13 PE=1 SV=3
2	AFDB:A0A0R4IQZ2	0.900	0.869	6.372E-56	645	0.506	0.488	A0A0R4IQZ2.pdb.gz	ZDH13_DANRE Putative palmitoyltransferase ZDHHC13 OS=Danio rerio OX=7955 GN=zdhhc13 PE=2 SV=1
3	AFDB:Q80TN5	0.839	0.826	4.925E-53	632	0.479	0.472	Q80TN5.pdb.gz	ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus OX=10090 GN=Zdhhc17 PE=1 SV=2
4	AFDB:A5WVX9	0.849	0.851	8.845E-53	620	0.473	0.474	A5WVX9.pdb.gz	ZDH17_DANRE Palmitoyltransferase ZDHHC17 OS=Danio rerio OX=7955 GN=zdhhc17 PE=2 SV=1
5	AFDB:Q9VUW9	0.812	0.794	5.033E-44	637	0.365	0.356	Q9VUW9.pdb.gz	HIP14_DROME Palmitoyltransferase Hip14 OS=Drosophila melanogaster OX=7227 GN=Hip14 PE=1 SV=1
6	AFDB:Q09701	0.735	0.714	6.756E-26	642	0.233	0.226	Q09701.pdb.gz	AKR1_SCHPO Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=akr1 PE=3 SV=1
7	AFDB:P39010	0.698	0.578	7.987E-26	764	0.248	0.202	P39010.pdb.gz	AKR1_YEAST Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AKR1 PE=1 SV=1
8	AFDB:Q12013	0.674	0.569	3.600E-25	749	0.217	0.180	Q12013.pdb.gz	AKR2_YEAST Probable palmitoyltransferase AKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AKR2 PE=1 SV=1
9	AFDB:Q3EC11	0.514	0.580	3.576E-22	536	0.214	0.248	Q3EC11.pdb.gz	ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana OX=3702 GN=PAT23 PE=2 SV=2
10	AFDB:Q52T38	0.527	0.529	4.054E-22	620	0.211	0.211	Q52T38.pdb.gz	ZDH22_ARATH Protein S-acyltransferase 24 OS=Arabidopsis thaliana OX=3702 GN=PAT24 PE=1 SV=1
11	PDB:8cs9A	0.335	0.264	1.997E-10	796	0.101	0.079	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:2dvwA	0.324	0.814	5.912E-9	229	0.095	0.258	2dvwA.pdb.gz
13	PDB:4oauC	0.264	0.241	6.428E-9	692	0.098	0.088	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:1wg0A	0.306	0.725	6.702E-9	243	0.095	0.243	1wg0A.pdb.gz
15	PDB:5vkqA	0.311	0.135	9.366E-9	1499	0.143	0.059	5vkqA.pdb.gz
16	PDB:6v9hC	0.306	0.663	1.204E-8	270	0.095	0.219	6v9hC.pdb.gz
17	PDB:6jd6B	0.241	0.750	6.151E-8	192	0.069	0.224	6jd6B.pdb.gz
18	PDB:6bmsD	0.324	0.680	5.192E-7	282	0.100	0.220	6bmsD.pdb.gz	Fatty acyl recognition and transfer by an integral membraneS-acyltransferase.
19	PDB:6pqpA	0.292	0.295	6.137E-7	615	0.137	0.138	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
20	PDB:6mwqA	0.185	0.226	1.540E-6	493	0.088	0.112	6mwqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IQZ2	0.0	640	645	0.487	0.470	ZDH13_DANRE Putative palmitoyltransferase ZDHHC13 OS=Danio rerio OX=7955 GN=zdhhc13 PE=2 SV=1
2	A5WVX9	0.0	622	620	0.471	0.473	ZDH17_DANRE Palmitoyltransferase ZDHHC17 OS=Danio rerio OX=7955 GN=zdhhc17 PE=2 SV=1
3	Q80TN5	0.0	612	632	0.469	0.462	ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus OX=10090 GN=Zdhhc17 PE=1 SV=2
4	Q8IUH4	0.0	1291	622	1.000	1.000	ZDH13_HUMAN Palmitoyltransferase ZDHHC13 OS=Homo sapiens OX=9606 GN=ZDHHC13 PE=1 SV=3
5	Q8IUH5	0.0	614	632	0.468	0.460	ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens OX=9606 GN=ZDHHC17 PE=1 SV=2
6	Q9CWU2	0.0	1202	622	0.912	0.912	ZDH13_MOUSE Palmitoyltransferase ZDHHC13 OS=Mus musculus OX=10090 GN=Zdhhc13 PE=1 SV=2
7	Q9VUW9	1.39e-142	430	637	0.371	0.363	HIP14_DROME Palmitoyltransferase Hip14 OS=Drosophila melanogaster OX=7227 GN=Hip14 PE=1 SV=1
8	Q09701	1.49e-51	190	642	0.219	0.212	AKR1_SCHPO Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=akr1 PE=3 SV=1
9	P39010	3.03e-47	179	764	0.262	0.213	AKR1_YEAST Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AKR1 PE=1 SV=1
10	Q3EC11	6.73e-42	161	536	0.238	0.276	ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana OX=3702 GN=PAT23 PE=2 SV=2
11	Q12013	5.88e-40	158	749	0.248	0.206	AKR2_YEAST Probable palmitoyltransferase AKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AKR2 PE=1 SV=1
12	Q9VKB1	5.50e-37	147	585	0.243	0.258	Q9VKB1_DROME Palmitoyltransferase OS=Drosophila melanogaster OX=7227 GN=Patsas PE=2 SV=1
13	Q52T38	3.61e-35	142	620	0.238	0.239	ZDH22_ARATH Protein S-acyltransferase 24 OS=Arabidopsis thaliana OX=3702 GN=PAT24 PE=1 SV=1
14	Q9U722	1.03e-34	139	444	0.188	0.264	Q9U722_DROME Palmitoyltransferase OS=Drosophila melanogaster OX=7227 GN=Patsas PE=3 SV=1
15	A8TT22	1.24e-17	89.7	1173	0.116	0.061	A8TT22_DANRE Euchromatic histone lysine N-mthyltransferase EHMT2/G9a OS=Danio rerio OX=7955 GN=g9a PE=1 SV=1
16	Q6TGV5	1.86e-17	84.0	226	0.092	0.252	Q6TGV5_DANRE 26S proteasome non-ATPase regulatory subunit 10 OS=Danio rerio OX=7955 GN=PSMD10 PE=1 SV=1
17	G5ECZ1	2.07e-17	89.4	1867	0.124	0.041	G5ECZ1_CAEEL AO66 ankyrin OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
18	Q17490	2.42e-17	89.4	6994	0.124	0.011	Q17490_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=2
19	Q804S5	7.24e-17	87.0	1030	0.122	0.074	MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX=7955 GN=mib1 PE=1 SV=1
20	Q86YT6	8.65e-17	87.0	1006	0.121	0.075	MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens OX=9606 GN=MIB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.3e-17	74.5	Ankyrin repeat
2	PF12796 Ank_2	2.9e-25	100.0	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	3.9e-22	86.8	Ankyrin repeat
4	PF13637 Ank_4	1.1e-26	104.1	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.9e-25	99.9	Ankyrin repeats (many copies)
6	PF01529 DHHC	1.5e-26	104.6	DHHC palmitoyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400113

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347184	0.772	Huntingtin
2	9606.ENSP00000341911	0.766	Paralemmin-1
3	9606.ENSP00000444201	0.733	Synaptotagmin-7
4	9606.ENSP00000309087	0.723	PLAC8-like protein 1
5	9606.ENSP00000222032	0.704	Cornifelin
6	9606.ENSP00000442373	0.694	Probable palmitoyltransferase ZDHHC11B
7	9606.ENSP00000318222	0.636	Palmitoyltransferase ZDHHC22
8	9606.ENSP00000307093	0.633	Microtubule-associated protein 6
9	9606.ENSP00000255006	0.627	Ras and Rab interactor 2
10	9606.ENSP00000376652	0.614	Ena/VASP-like protein
11	9606.ENSP00000254976	0.592	Synaptosomal-associated protein 25
12	9606.ENSP00000377520	0.584	Synaptotagmin-12
13	9606.ENSP00000379133	0.571	Methylthioribulose-1-phosphate dehydratase
14	9606.ENSP00000472802	0.562	Zinc finger protein 446
15	9606.ENSP00000261205	0.554	Synaptotagmin-1
16	9606.ENSP00000271375	0.534	Vesicle transport protein SFT2B
17	9606.ENSP00000364721	0.534	Microtubule-associated protein RP/EB family member 1
18	9606.ENSP00000283441	0.526	Probable palmitoyltransferase ZDHHC11
19	9606.ENSP00000348821	0.520	Myomesin-1
20	9606.ENSP00000384192	0.519	Ras guanyl-releasing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016409	1.000	palmitoyltransferase activity
GO:0015095	0.989	magnesium ion transmembrane transporter activity
GO:0016417	0.959	S-acyltransferase activity
GO:0019707	0.950	protein-cysteine S-acyltransferase activity
GO:0019706	0.944	protein-cysteine S-palmitoyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.964	cellular process
GO:0048518	0.940	positive regulation of biological process
GO:0048522	0.929	positive regulation of cellular process
GO:0048583	0.793	regulation of response to stimulus
GO:0023051	0.739	regulation of signaling
GO:0010646	0.696	regulation of cell communication
GO:0009966	0.666	regulation of signal transduction
GO:0071704	0.596	organic substance metabolic process
GO:0044238	0.577	primary metabolic process
GO:0044237	0.575	cellular metabolic process
GO:0006807	0.541	nitrogen compound metabolic process
GO:1902531	0.533	regulation of intracellular signal transduction
GO:0043122	0.449	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0009967	0.435	positive regulation of signal transduction
GO:0043170	0.421	macromolecule metabolic process
GO:1901564	0.417	organonitrogen compound metabolic process
GO:0043123	0.399	positive regulation of I-kappaB kinase/NF-kappaB signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0031090	0.875	organelle membrane
GO:0005794	0.747	Golgi apparatus
GO:0031982	0.653	vesicle
GO:0098588	0.615	bounding membrane of organelle
GO:0031410	0.574	cytoplasmic vesicle
GO:0005783	0.537	endoplasmic reticulum
GO:0030659	0.378	cytoplasmic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:29827	0.989	Mg(2+)(in) = Mg(2+)(out)
RHEA:63372	0.950	an acyl-CoA + L-cysteinyl-[protein] = an S-acyl-L-cysteinyl-[protein] + CoA
RHEA:36683	0.944	hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein]
EC:2.3.1.225	0.944	protein S-acyltransferase.

[back to server]