StarFunc result for job id Q8IUI8

User Input

>input (442 residues)
MRGAMELEPELLLQEARENVEAAQSYRRELGHRLEGLREARRQIKESASQTRDVLKQHFN
DLKGTLGKLLDERLVTLLQEVDTIEQETIKPLDDCQKLIEHGVNTAEDLVREGEIAMLGG
VGEENEKLWSFTKKASHIQLDSLPEVPLLVDVPCLSAQLDDSILNIVKDHIFKHGTVASR
PPVQIEELIEKPGGIIVRWCKVDDDFTAQDYRLQFRKCTSNHFEDVYVGSETEFIVLHID
PNVDYQFRVCARGDGRQEWSPWSVPQIGHSTLVPHEWTAGFEGYSLSSRRNIALRNDSES
SGVLYSRAPTYFCGQTLTFRVETVGQPDRRDSIGVCAEKQDGYDSLQRDQAVCISTNGAV
FVNGKEMTNQLPAVTSGSTVTFDIEAVTLGTTSNNEGGHFKLRVTISSNNREVVFDWLLD
QSCGSLYFGCSFFYPGWKVLVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IUI8	1.000	1.000	1.498E-74	442	1.000	1.000	Q8IUI8.pdb.gz	CRLF3_HUMAN Cytokine receptor-like factor 3 OS=Homo sapiens OX=9606 GN=CRLF3 PE=1 SV=2
2	AFDB:Q91ZY8	0.287	0.190	1.198E-16	710	0.167	0.104	Q91ZY8.pdb.gz	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
3	AFDB:M9MRI4	0.289	0.184	1.261E-16	740	0.154	0.092	M9MRI4.pdb.gz	TRIM9_DROME E3 ubiquitin-protein ligase TRIM9 OS=Drosophila melanogaster OX=7227 GN=Trim9 PE=1 SV=1
4	AFDB:Q505D9	0.288	0.178	3.176E-16	768	0.149	0.086	Q505D9.pdb.gz	TRI67_MOUSE Tripartite motif-containing protein 67 OS=Mus musculus OX=10090 GN=Trim67 PE=2 SV=1
5	AFDB:Q9UAQ3	0.271	0.169	4.790E-16	765	0.174	0.101	Q9UAQ3.pdb.gz	Q9UAQ3_CAEEL E3 ubiquitin-protein ligase TRIM9 OS=Caenorhabditis elegans OX=6239 GN=madd-2 PE=4 SV=2
6	AFDB:Q8C7M3	0.282	0.161	8.869E-16	817	0.161	0.087	Q8C7M3.pdb.gz	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
7	AFDB:Q80WG7	0.234	0.156	1.862E-12	729	0.161	0.097	Q80WG7.pdb.gz	TRI36_MOUSE E3 ubiquitin-protein ligase Trim36 OS=Mus musculus OX=10090 GN=Trim36 PE=1 SV=2
8	AFDB:Q9UJV3	0.303	0.198	2.667E-12	735	0.140	0.084	Q9UJV3.pdb.gz	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
9	AFDB:O70583	0.305	0.215	2.955E-12	680	0.147	0.096	O70583.pdb.gz	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
10	AFDB:Q1LY10	0.421	0.389	1.975E-11	495	0.133	0.119	Q1LY10.pdb.gz	FSD1_DANRE Fibronectin type III and SPRY domain-containing protein 1 OS=Danio rerio OX=7955 GN=fsd1 PE=3 SV=1
11	PDB:5iv5BJ	0.182	0.087	6.052E-5	1004	0.088	0.039	5iv5BJ.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
12	PDB:7nscA	0.293	0.446	8.669E-5	276	0.054	0.087	7nscA.pdb.gz
13	PDB:6m5yA	0.193	0.287	1.121E-4	270	0.086	0.141	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
14	PDB:6pxvA	0.178	0.102	1.690E-4	823	0.043	0.023	6pxvA.pdb.gz
15	PDB:1f13A	0.154	0.106	1.779E-4	722	0.068	0.042	1f13A.pdb.gz
16	PDB:4uflA	0.224	0.165	2.075E-4	641	0.090	0.062	4uflA.pdb.gz	Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
17	PDB:6swy1	0.233	0.195	3.294E-4	542	0.048	0.039	6swy1.pdb.gz
18	PDB:7ccbA	0.259	0.622	4.257E-4	164	0.052	0.140	7ccbA.pdb.gz
19	PDB:8eyyA	0.176	0.106	4.718E-4	775	0.061	0.035	8eyyA.pdb.gz
20	PDB:7y4sA	0.168	0.209	5.228E-4	343	0.133	0.172	7y4sA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IUI8	0.0	915	442	1.000	1.000	CRLF3_HUMAN Cytokine receptor-like factor 3 OS=Homo sapiens OX=9606 GN=CRLF3 PE=1 SV=2
2	Q8BZ52	0.007	41.2	716	0.115	0.071	FSD2_MOUSE Fibronectin type III and SPRY domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fsd2 PE=1 SV=3
3	Q90374	0.025	39.7	830	0.045	0.024	PRLR_COLLI Prolactin receptor OS=Columba livia OX=8932 GN=PRLR PE=2 SV=1
4	A8DYP0	0.026	39.7	4218	0.054	0.006	OBSCN_DROME Obscurin OS=Drosophila melanogaster OX=7227 GN=Unc-89 PE=1 SV=1
5	Q9VJJ8	0.026	39.7	1413	0.077	0.024	Q9VJJ8_DROME LD30602p OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=2
6	Q9VJJ9	0.029	39.3	1762	0.077	0.019	Q9VJJ9_DROME FI20237p1 OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=4
7	M9PD19	0.031	39.3	1779	0.077	0.019	M9PD19_DROME Miles to go, isoform H OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
8	B7YZW3	0.032	39.3	2064	0.077	0.016	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
9	Q04594	0.037	38.9	831	0.048	0.025	PRLR_CHICK Prolactin receptor OS=Gallus gallus OX=9031 GN=PRLR PE=2 SV=1
10	Q5VWK5	0.081	37.7	629	0.038	0.027	IL23R_HUMAN Interleukin-23 receptor OS=Homo sapiens OX=9606 GN=IL23R PE=1 SV=3
11	Q53EP0	0.21	36.6	1204	0.061	0.022	FND3B_HUMAN Fibronectin type III domain-containing protein 3B OS=Homo sapiens OX=9606 GN=FNDC3B PE=1 SV=2
12	Q6NWW9	0.21	36.6	1207	0.061	0.022	FND3B_MOUSE Fibronectin type III domain-containing protein 3B OS=Mus musculus OX=10090 GN=Fndc3b PE=1 SV=1
13	H0UZ81	0.42	35.4	719	0.120	0.074	FSD2_CAVPO Fibronectin type III and SPRY domain-containing protein 2 OS=Cavia porcellus OX=10141 GN=FSD2 PE=2 SV=2
14	Q62959	0.87	34.7	1162	0.054	0.021	LEPR_RAT Leptin receptor OS=Rattus norvegicus OX=10116 GN=Lepr PE=1 SV=1
15	Q8BX90	0.94	34.7	1198	0.057	0.021	FND3A_MOUSE Fibronectin type-III domain-containing protein 3A OS=Mus musculus OX=10090 GN=Fndc3a PE=1 SV=3
16	P29728	1.9	33.5	719	0.038	0.024	OAS2_HUMAN 2'-5'-oligoadenylate synthase 2 OS=Homo sapiens OX=9606 GN=OAS2 PE=1 SV=3
17	Q2EY15	2.3	33.1	1191	0.045	0.017	PRTG_MOUSE Protogenin OS=Mus musculus OX=10090 GN=Prtg PE=2 SV=1
18	Q2VWP7	2.3	33.1	1150	0.045	0.017	PRTG_HUMAN Protogenin OS=Homo sapiens OX=9606 GN=PRTG PE=2 SV=1
19	P40189	2.5	33.1	918	0.036	0.017	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
20	Q17RA0	2.6	33.1	918	0.036	0.017	Q17RA0_HUMAN Interleukin 6 signal transducer (Gp130, oncostatin M receptor) OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	0.85	21.3	Fibronectin type III domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318804

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000329468	0.854	Arf-GAP with dual PH domain-containing protein 2
2	9606.ENSP00000261708	0.765	U3 small nucleolar RNA-associated protein 6 homolog
3	9606.ENSP00000313171	0.758	ATPase family AAA domain-containing protein 5
4	9606.ENSP00000462963	0.756	Transcription elongation factor, mitochondrial
5	9606.ENSP00000222139	0.747	Erythropoietin receptor
6	9606.ENSP00000337850	0.716	KICSTOR complex protein kaptin
7	9606.ENSP00000351052	0.712	Nuclear-interacting partner of ALK
8	9606.ENSP00000228820	0.698	Poly [ADP-ribose] polymerase 11
9	9606.ENSP00000349687	0.686	Ganglioside GM2 activator
10	9606.ENSP00000263549	0.682	poly(ADP-ribose) polymerase family member 12
11	9606.ENSP00000362170	0.665	Nuclear apoptosis-inducing factor 1
12	9606.ENSP00000253794	0.660	Vacuolar protein-sorting-associated protein 25
13	9606.ENSP00000431391	0.653	Apoptosis inhibitor 5
14	9606.ENSP00000221847	0.642	Interleukin-27 subunit beta
15	9606.ENSP00000242351	0.642	Zinc finger CCCH-type antiviral protein 1
16	9606.ENSP00000340519	0.636	Leucine-rich repeat-containing protein 37B
17	9606.ENSP00000378624	0.631	Probable E3 ubiquitin-protein ligase HERC4
18	9606.ENSP00000359042	0.616	Pre-mRNA-splicing factor 38B
19	9606.ENSP00000378165	0.615	BUB3-interacting and GLEBS motif-containing protein ZNF207
20	9606.ENSP00000328340	0.605	E3 ubiquitin-protein ligase RNF135

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009967	0.978	positive regulation of signal transduction
GO:0010564	0.977	regulation of cell cycle process
GO:0051173	0.972	positive regulation of nitrogen compound metabolic process
GO:1904892	0.972	regulation of receptor signaling pathway via STAT
GO:0040008	0.969	regulation of growth
GO:0031325	0.966	positive regulation of cellular metabolic process
GO:0045893	0.960	positive regulation of DNA-templated transcription
GO:0048523	0.957	negative regulation of cellular process
GO:1901987	0.949	regulation of cell cycle phase transition
GO:0051128	0.923	regulation of cellular component organization
GO:0007346	0.912	regulation of mitotic cell cycle
GO:1904894	0.911	positive regulation of receptor signaling pathway via STAT
GO:0046425	0.906	regulation of receptor signaling pathway via JAK-STAT
GO:0046427	0.884	positive regulation of receptor signaling pathway via JAK-STAT
GO:0045786	0.861	negative regulation of cell cycle
GO:1901990	0.861	regulation of mitotic cell cycle phase transition
GO:0006357	0.857	regulation of transcription by RNA polymerase II
GO:1901988	0.833	negative regulation of cell cycle phase transition
GO:1902806	0.826	regulation of cell cycle G1/S phase transition
GO:2000045	0.793	regulation of G1/S transition of mitotic cell cycle
GO:0045930	0.779	negative regulation of mitotic cell cycle
GO:0001558	0.762	regulation of cell growth
GO:1902807	0.761	negative regulation of cell cycle G1/S phase transition
GO:0045926	0.759	negative regulation of growth
GO:1901991	0.658	negative regulation of mitotic cell cycle phase transition
GO:0009987	0.642	cellular process
GO:2000134	0.618	negative regulation of G1/S transition of mitotic cell cycle
GO:0045944	0.480	positive regulation of transcription by RNA polymerase II
GO:0030308	0.310	negative regulation of cell growth

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.999	plasma membrane
GO:0043229	0.956	intracellular organelle
GO:0043227	0.893	membrane-bounded organelle
GO:0043231	0.845	intracellular membrane-bounded organelle
GO:0005634	0.814	nucleus
GO:0070013	0.767	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]