StarFunc result for job id Q8IUL8

User Input

>input (1156 residues)
MASLLPLLCLCVVAAHLAGARDATPTEEPMATALGLERRSVYTGQPSPALEDWEEASEWT
SWFNVDHPGGDGDFESLAAIRFYYGPARVCPRPLALEARTTDWALPSAVGERVHLNPTRG
FWCLNREQPRGRRCSNYHVRFRCPLEASWGAWGPWGPCSGSCGPGRRLRRRHCPSPAGDA
CPGRPLEAQKCVRPRCPGCSLDTCECPDHILLGSVVTPSGQPLLGARVSLRDQPGTVATS
DAHGTFRVPGVCADSRANIRAQMDGFSAGEAQAQANGSISVVTIILDKLEKPYLVKHPES
RVREAGQNVTFCCKASGTPMPKKYSWFHNGTLLDRRAHGYGAHLELRGLRPDQAGIYHCK
AWNEAGAVRSGTARLTVLAPGQPACDPRPREYLIKLPEDCGQPGSGPAYLDVGLCPDTRC
PSLAGSSPRCGDASSRCCSVRRLERREIHCPGYVLPVKVVAECGCQKCLPPRGLVRGRVV
AADSGEPLRFARILLGQEPIGFTAYQGDFTIEVPPSTQRLVVTFVDPSGEFMDAVRVLPF
DPRGAGVYHEVKAMRKKAPVILHTSQSNTIPLGELEDEAPLGELVLPSGAFRRADGKPYS
GPVEARVTFVDPRDLTSAASAPSDLRFVDSDGELAPLRTYGMFSVDLRAPGSAEQLQVGP
VAVRVAASQIHMPGHVEALKLWSLNPETGLWEEESGFRREGSSGPRVRREERVFLVGNVE
IRERRLFNLDVPERRRCFVKVRAYANDKFTPSEQVEGVVVTLVNLEPAPGFSANPRAWGR
FDSAVTGPNGACLPAFCDADRPDAYTALVTATLGGEELEPAPSLPRPLPATVGVTQPYLD
RLGYRRTDHDDPAFKRNGFRINLAKPRPGDPAEANGPVYPWRSLRECQGAPVTASHFRFA
RVEADKYEYNVVPFREGTPASWTGDLLAWWPNPQEFRACFLKVKIQGPQEYMVRSHNAGG
SHPRTRGQLYGLRDARSVRDPERPGTSAACVEFKCSGMLFDQRQVDRTLVTIMPQGSCRR
VAVNGLLRDYLTRHPPPVPAEDPAAFSMLAPLDPLGHNYGVYTVTDQSPRLAKEIAIGRC
FDGSSDGFSREMKADAGTAVTFQCREPPAGRPSLFQRLLESPATALGDIRREMSEAAQAQ
ARASGPLRTRRGRVRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75339	0.767	0.749	0.000	1184	0.496	0.484	O75339.pdb.gz	CILP1_HUMAN Cartilage intermediate layer protein 1 OS=Homo sapiens OX=9606 GN=CILP PE=1 SV=4
2	AFDB:Q8IUL8	1.000	1.000	0.000	1156	1.000	1.000	Q8IUL8.pdb.gz	CILP2_HUMAN Cartilage intermediate layer protein 2 OS=Homo sapiens OX=9606 GN=CILP2 PE=2 SV=2
3	AFDB:Q2EY15	0.093	0.091	1.647E-15	1191	0.119	0.116	Q2EY15.pdb.gz	PRTG_MOUSE Protogenin OS=Mus musculus OX=10090 GN=Prtg PE=2 SV=1
4	AFDB:A0A2R8QRK0	0.094	0.079	6.808E-15	1420	0.095	0.077	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
5	AFDB:Q63198	0.077	0.087	7.926E-15	1021	0.097	0.110	Q63198.pdb.gz	CNTN1_RAT Contactin-1 OS=Rattus norvegicus OX=10116 GN=Cntn1 PE=1 SV=2
6	AFDB:Q2EY14	0.100	0.100	1.021E-14	1149	0.111	0.111	Q2EY14.pdb.gz	PRTGA_DANRE Protogenin A OS=Danio rerio OX=7955 GN=prtga PE=2 SV=1
7	AFDB:Q9W213	0.089	0.077	1.021E-14	1395	0.101	0.084	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
8	AFDB:O55005	0.084	0.063	1.130E-14	1651	0.103	0.072	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
9	AFDB:Q9VPZ7	0.086	0.077	2.076E-14	1342	0.082	0.071	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
10	AFDB:A0A0G2JZA1	0.097	0.076	2.184E-14	1512	0.094	0.072	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
11	PDB:6dldD	0.073	0.284	6.335E-10	269	0.038	0.164	6dldD.pdb.gz
12	PDB:6dlfA	0.074	0.314	4.253E-8	236	0.030	0.148	6dlfA.pdb.gz
13	PDB:1e07A	0.080	0.121	4.474E-8	642	0.060	0.107	1e07A.pdb.gz
14	PDB:5a42A	0.089	0.069	9.362E-7	1597	0.090	0.065	5a42A.pdb.gz
15	PDB:5oj2B	0.080	0.120	1.090E-6	692	0.065	0.108	5oj2B.pdb.gz
16	PDB:4aq1A	0.073	0.100	2.714E-6	721	0.072	0.115	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
17	PDB:4lnvA	0.075	0.070	1.521E-5	1276	0.081	0.074	4lnvA.pdb.gz
18	PDB:7q1yA	0.069	0.063	1.600E-5	1374	0.080	0.068	7q1yA.pdb.gz
19	PDB:5c6wJ	0.066	0.294	2.399E-5	238	0.037	0.181	5c6wJ.pdb.gz
20	PDB:7vonA	0.082	0.074	2.399E-5	1399	0.087	0.072	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75339	0.0	1196	1184	0.496	0.484	CILP1_HUMAN Cartilage intermediate layer protein 1 OS=Homo sapiens OX=9606 GN=CILP PE=1 SV=4
2	Q8IUL8	0.0	2344	1156	1.000	1.000	CILP2_HUMAN Cartilage intermediate layer protein 2 OS=Homo sapiens OX=9606 GN=CILP2 PE=2 SV=2
3	D3YXG0	1.97e-08	61.6	5634	0.022	0.005	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
4	Q32MD9	3.19e-08	60.5	1250	0.030	0.028	CDON_MOUSE Cell adhesion molecule-related/down-regulated by oncogenes OS=Mus musculus OX=10090 GN=Cdon PE=1 SV=2
5	Q9UHI8	5.51e-08	59.7	967	0.031	0.037	ATS1_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Homo sapiens OX=9606 GN=ADAMTS1 PE=1 SV=4
6	Q96RW7	6.34e-08	60.1	5635	0.022	0.004	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
7	Q8BQC3	8.25e-08	58.9	813	0.029	0.042	IGDC3_MOUSE Immunoglobulin superfamily DCC subclass member 3 OS=Mus musculus OX=10090 GN=Igdcc3 PE=2 SV=1
8	Q2VWP7	1.30e-07	58.5	1150	0.035	0.035	PRTG_HUMAN Protogenin OS=Homo sapiens OX=9606 GN=PRTG PE=2 SV=1
9	Q2EY15	1.72e-07	58.2	1191	0.036	0.035	PRTG_MOUSE Protogenin OS=Mus musculus OX=10090 GN=Prtg PE=2 SV=1
10	P98088	2.28e-07	58.2	5654	0.031	0.006	MUC5A_HUMAN Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 SV=4
11	O35158	4.80e-07	56.6	1256	0.028	0.025	CDON_RAT Cell adhesion molecule-related/down-regulated by oncogenes OS=Rattus norvegicus OX=10116 GN=Cdon PE=1 SV=2
12	Q967X6	4.84e-07	56.6	939	0.041	0.050	Q967X6_DROME Sidestep OS=Drosophila melanogaster OX=7227 GN=side PE=2 SV=1
13	A0A0B4K7N1	5.72e-07	56.6	986	0.041	0.048	A0A0B4K7N1_DROME Sidestep, isoform C OS=Drosophila melanogaster OX=7227 GN=side PE=4 SV=1
14	Q9VB35	6.19e-07	56.2	939	0.041	0.050	Q9VB35_DROME Sidestep, isoform A OS=Drosophila melanogaster OX=7227 GN=side PE=1 SV=2
15	A0A0B4K6K0	6.46e-07	56.2	943	0.041	0.050	A0A0B4K6K0_DROME Sidestep, isoform D OS=Drosophila melanogaster OX=7227 GN=side PE=4 SV=1
16	B7Z0R1	7.89e-07	55.8	929	0.041	0.051	B7Z0R1_DROME Sidestep, isoform B OS=Drosophila melanogaster OX=7227 GN=side PE=4 SV=1
17	A2A3C1	8.36e-07	56.2	1466	0.024	0.019	A2A3C1_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
18	Q05BQ1	1.04e-06	55.8	1179	0.038	0.037	TUTLA_MOUSE Protein turtle homolog A OS=Mus musculus OX=10090 GN=Igsf9 PE=1 SV=2
19	A2A3C6	1.12e-06	55.5	1500	0.022	0.017	A2A3C6_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
20	A2A3C3	1.26e-06	55.5	1499	0.022	0.017	A2A3C3_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13715 CarbopepD_reg_2	2e-05	35.8	CarboxypepD_reg-like domain
2	PF13620 CarboxypepD_reg	1.1e-08	46.5	Carboxypeptidase regulatory-like domain
3	PF07679 I-set	7.2e-05	34.1	Immunoglobulin I-set domain
4	PF00047 ig	0.73	21.4	Immunoglobulin domain
5	PF13895 Ig_2	0.0028	29.3	Immunoglobulin domain
6	PF13927 Ig_3	5.1e-09	47.9	Immunoglobulin domain
7	PF13330 Mucin2_WxxW	1.6e-15	69.0	Mucin-2 protein WxxW repeating region
8	PF19030 TSP1_ADAMTS	29	16.4	Thrombospondin type 1 domain
9	PF19028 TSP1_spondin	0.15	23.7	Spondin-like TSP1 domain
10	PF00090 TSP_1	5.4e-06	37.8	Thrombospondin type 1 domain
11	PF07686 V-set	63	15.2	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291495

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251203	0.806	Pre-B-cell leukemia transcription factor 4
2	9606.ENSP00000374014	0.694	Transmembrane 6 superfamily member 2
3	9606.ENSP00000351644	0.689	tRNA modification GTPase GTPBP3, mitochondrial
4	9606.ENSP00000312150	0.653	Tribbles homolog 1
5	9606.ENSP00000483552	0.648	Furin
6	9606.ENSP00000355632	0.637	Polypeptide N-acetylgalactosaminyltransferase 2
7	9606.ENSP00000360170	0.617	Angiopoietin-related protein 3
8	9606.ENSP00000252575	0.616	Neurocan core protein
9	9606.ENSP00000358925	0.616	Proline/serine-rich coiled-coil protein 1
10	9606.ENSP00000271332	0.600	Cadherin EGF LAG seven-pass G-type receptor 2
11	9606.ENSP00000445920	0.562	Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
12	9606.ENSP00000256637	0.556	Sortilin
13	9606.ENSP00000355895	0.545	Lysophospholipase-like protein 1
14	9606.ENSP00000426964	0.545	YjeF N-terminal domain-containing protein 3
15	9606.ENSP00000264717	0.530	Glucokinase regulatory protein
16	9606.ENSP00000377233	0.529	Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1
17	9606.ENSP00000299022	0.518	Hepatic triacylglycerol lipase
18	9606.ENSP00000320886	0.518	Carbohydrate-responsive element-binding protein
19	9606.ENSP00000307260	0.517	Transducin beta-like protein 2
20	9606.ENSP00000222271	0.510	Cartilage oligomeric matrix protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.918	cellular process
GO:0048519	0.838	negative regulation of biological process
GO:0019222	0.719	regulation of metabolic process
GO:0048523	0.716	negative regulation of cellular process
GO:0060255	0.627	regulation of macromolecule metabolic process
GO:0048583	0.602	regulation of response to stimulus
GO:0071704	0.506	organic substance metabolic process
GO:0010646	0.441	regulation of cell communication
GO:0044238	0.435	primary metabolic process
GO:0010468	0.414	regulation of gene expression
GO:0071840	0.408	cellular component organization or biogenesis
GO:0016043	0.364	cellular component organization
GO:0023051	0.362	regulation of signaling
GO:0050896	0.346	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070062	0.999	extracellular exosome
GO:0043231	0.936	intracellular membrane-bounded organelle
GO:0005737	0.793	cytoplasm
GO:0031974	0.747	membrane-enclosed lumen
GO:0070013	0.703	intracellular organelle lumen
GO:0005634	0.651	nucleus
GO:0071944	0.473	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]