StarFunc result for job id Q8IUQ4

User Input

>input (282 residues)
MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHL
VCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEEL
CEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVM
MQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
RSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61092	0.953	0.953	4.084E-61	282	0.996	0.996	P61092.pdb.gz	SIA1A_MOUSE E3 ubiquitin-protein ligase SIAH1A OS=Mus musculus OX=10090 GN=Siah1a PE=1 SV=1
2	AFDB:Q06986	0.876	0.762	3.970E-51	325	0.766	0.665	Q06986.pdb.gz	SIAH2_MOUSE E3 ubiquitin-protein ligase SIAH2 OS=Mus musculus OX=10090 GN=Siah2 PE=1 SV=2
3	AFDB:P21461	0.878	0.789	1.915E-50	314	0.759	0.682	P21461.pdb.gz	SINA_DROME E3 ubiquitin-protein ligase sina OS=Drosophila melanogaster OX=7227 GN=sina PE=1 SV=2
4	AFDB:Q965X6	0.856	0.584	8.161E-49	419	0.663	0.446	Q965X6.pdb.gz	SIAH1_CAEEL E3 ubiquitin-protein ligase siah-1 OS=Caenorhabditis elegans OX=6239 GN=siah-1 PE=1 SV=3
5	AFDB:Q8T3Y0	0.810	0.658	2.669E-39	351	0.472	0.379	Q8T3Y0.pdb.gz	SINAL_DROME Probable E3 ubiquitin-protein ligase sinah OS=Drosophila melanogaster OX=7227 GN=sinah PE=1 SV=2
6	AFDB:Q9M2P4	0.790	0.728	1.514E-31	308	0.337	0.308	Q9M2P4.pdb.gz	SINA2_ARATH E3 ubiquitin-protein ligase SINAT2 OS=Arabidopsis thaliana OX=3702 GN=SINAT2 PE=1 SV=1
7	AFDB:Q8S3N1	0.787	0.724	1.421E-30	309	0.316	0.288	Q8S3N1.pdb.gz	SINA5_ARATH E3 ubiquitin-protein ligase SINAT5 OS=Arabidopsis thaliana OX=3702 GN=SINAT5 PE=1 SV=2
8	AFDB:Q10L91	0.785	0.739	1.810E-30	301	0.323	0.302	Q10L91.pdb.gz	DIS1_ORYSJ E3 ubiquitin-protein ligase DIS1 OS=Oryza sativa subsp. japonica OX=39947 GN=DIS1 PE=1 SV=1
9	AFDB:Q84JL3	0.726	0.640	4.766E-30	326	0.326	0.282	Q84JL3.pdb.gz	SINA3_ARATH E3 ubiquitin-protein ligase SINAT3 OS=Arabidopsis thaliana OX=3702 GN=SINAT3 PE=1 SV=1
10	AFDB:Q9STN8	0.757	0.662	8.217E-30	327	0.337	0.291	Q9STN8.pdb.gz	SINA4_ARATH E3 ubiquitin-protein ligase SINAT4 OS=Arabidopsis thaliana OX=3702 GN=SINAT4 PE=1 SV=1
11	PDB:5dkaA	0.253	0.639	2.017E-3	96	0.067	0.198	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:4r8pL	0.212	0.231	2.412E-2	254	0.103	0.114	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:5lj5t	0.137	0.091	5.298E-2	438	0.082	0.053	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
14	PDB:4akrB	0.160	0.177	8.597E-2	245	0.092	0.106	4akrB.pdb.gz
15	PDB:4ylbA	0.103	0.182	1.236E-1	128	0.074	0.164	4ylbA.pdb.gz
16	PDB:1iznA	0.156	0.160	1.395E-1	275	0.039	0.040	1iznA.pdb.gz
17	PDB:3k81D	0.164	0.358	1.482E-1	106	0.035	0.094	3k81D.pdb.gz
18	PDB:2z5eA	0.138	0.261	1.777E-1	122	0.028	0.066	2z5eA.pdb.gz
19	PDB:6xwvD	0.089	0.157	2.006E-1	123	0.032	0.073	6xwvD.pdb.gz	Structural basis for centromere maintenance by Drosophila CENP-A chaperone CAL1.
20	PDB:3bqbX	0.164	0.160	2.131E-1	291	0.078	0.076	3bqbX.pdb.gz	Structural insight into substrate binding and catalysis of a novel 2-keto-3-deoxy-D-arabinonate dehydratase illustrates common mechanistic features of the FAH superfamily

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61092	0.0	589	282	0.996	0.996	SIA1A_MOUSE E3 ubiquitin-protein ligase SIAH1A OS=Mus musculus OX=10090 GN=Siah1a PE=1 SV=1
2	Q06985	0.0	577	282	0.972	0.972	SIA1B_MOUSE E3 ubiquitin-protein ligase SIAH1B OS=Mus musculus OX=10090 GN=Siah1b PE=2 SV=2
3	Q8IUQ4	0.0	591	282	1.000	1.000	SIAH1_HUMAN E3 ubiquitin-protein ligase SIAH1 OS=Homo sapiens OX=9606 GN=SIAH1 PE=1 SV=2
4	Q920M9	0.0	589	282	0.996	0.996	SIAH1_RAT E3 ubiquitin-protein ligase SIAH1 OS=Rattus norvegicus OX=10116 GN=Siah1 PE=1 SV=2
5	Q06986	1.47e-163	458	325	0.759	0.658	SIAH2_MOUSE E3 ubiquitin-protein ligase SIAH2 OS=Mus musculus OX=10090 GN=Siah2 PE=1 SV=2
6	Q8R4T2	1.47e-163	458	325	0.759	0.658	SIAH2_RAT E3 ubiquitin-protein ligase SIAH2 OS=Rattus norvegicus OX=10116 GN=Siah2 PE=1 SV=2
7	O43255	2.19e-163	458	324	0.759	0.660	SIAH2_HUMAN E3 ubiquitin-protein ligase SIAH2 OS=Homo sapiens OX=9606 GN=SIAH2 PE=1 SV=1
8	P21461	2.27e-158	445	314	0.741	0.666	SINA_DROME E3 ubiquitin-protein ligase sina OS=Drosophila melanogaster OX=7227 GN=sina PE=1 SV=2
9	Q965X6	7.03e-141	404	419	0.649	0.437	SIAH1_CAEEL E3 ubiquitin-protein ligase siah-1 OS=Caenorhabditis elegans OX=6239 GN=siah-1 PE=1 SV=3
10	Q8T3Y0	1.16e-90	274	351	0.457	0.368	SINAL_DROME Probable E3 ubiquitin-protein ligase sinah OS=Drosophila melanogaster OX=7227 GN=sinah PE=1 SV=2
11	Q8IW03	6.26e-58	188	269	0.305	0.320	SIAH3_HUMAN Seven in absentia homolog 3 OS=Homo sapiens OX=9606 GN=SIAH3 PE=1 SV=3
12	Q9M2P4	9.13e-48	163	308	0.330	0.302	SINA2_ARATH E3 ubiquitin-protein ligase SINAT2 OS=Arabidopsis thaliana OX=3702 GN=SINAT2 PE=1 SV=1
13	P93748	1.30e-46	160	305	0.319	0.295	SINA1_ARATH Putative E3 ubiquitin-protein ligase SINAT1 OS=Arabidopsis thaliana OX=3702 GN=SINAT1 PE=1 SV=1
14	Q9STN8	2.80e-46	160	327	0.337	0.291	SINA4_ARATH E3 ubiquitin-protein ligase SINAT4 OS=Arabidopsis thaliana OX=3702 GN=SINAT4 PE=1 SV=1
15	Q84JL3	2.51e-45	157	326	0.326	0.282	SINA3_ARATH E3 ubiquitin-protein ligase SINAT3 OS=Arabidopsis thaliana OX=3702 GN=SINAT3 PE=1 SV=1
16	Q8S3N1	1.01e-44	155	309	0.312	0.285	SINA5_ARATH E3 ubiquitin-protein ligase SINAT5 OS=Arabidopsis thaliana OX=3702 GN=SINAT5 PE=1 SV=2
17	Q10L91	1.50e-44	154	301	0.312	0.292	DIS1_ORYSJ E3 ubiquitin-protein ligase DIS1 OS=Oryza sativa subsp. japonica OX=39947 GN=DIS1 PE=1 SV=1
18	Q9FKD7	5.42e-20	89.4	286	0.160	0.157	SINL7_ARATH E3 ubiquitin-protein ligase SINA-like 7 OS=Arabidopsis thaliana OX=3702 GN=At5g37890 PE=2 SV=1
19	Q9C9M0	3.14e-16	79.3	329	0.174	0.149	SINL4_ARATH E3 ubiquitin-protein ligase SINA-like 4 OS=Arabidopsis thaliana OX=3702 GN=At1g66650 PE=2 SV=1
20	Q93WE4	2.43e-13	69.7	216	0.156	0.204	SINA6_ARATH Probable inactive E3 ubiquitin-protein ligase SINAT6 OS=Arabidopsis thaliana OX=3702 GN=SINAT6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03145 Sina	4.9e-85	296.1	Seven in absentia protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 246437.XP_006155299.1

Rank	PPI partner	STRING score	Description
1	246437.XP_006153392.1	0.999	Calcyclin-binding protein
2	246437.XP_006146404.1	0.991	Axin-1
3	246437.XP_006170911.1	0.950	Glyceraldehyde-3-phosphate dehydrogenase
4	246437.XP_006171034.1	0.948	Laminin subunit beta-2
5	246437.XP_006146951.1	0.936	Adenomatous polyposis coli protein
6	246437.XP_006145157.1	0.933	Belongs to the protein kinase superfamily.
7	246437.XP_006143302.1	0.923	Alpha-synuclein isoform X1
8	246437.XP_006166045.1	0.916	Belongs to the protein kinase superfamily.
9	246437.XP_006142199.1	0.870	Glycogen synthase kinase-3 alpha
10	246437.XP_006167540.1	0.819	Synphilin-1
11	246437.XP_006149846.1	0.817	Uncharacterized protein LOC102475209
12	246437.XP_006147142.1	0.811	Ubiquitin-conjugating enzyme E2 D1
13	246437.XP_006146819.1	0.795	Axin-2
14	246437.XP_006150935.1	0.745	Casein kinase I isoform alpha
15	246437.XP_006171691.1	0.724	Belongs to the glyceraldehyde-3-phosphate dehydrogenase family
16	246437.XP_006166919.1	0.713	S-phase kinase-associated protein 1 isoform X1
17	246437.XP_006159895.1	0.694	Belongs to the S-100 family.
18	246437.XP_006149690.1	0.693	Homeodomain-interacting protein kinase 1
19	246437.XP_006171828.1	0.675	APC2, WNT signaling pathway regulator
20	246437.XP_006157548.1	0.671	Paternally expressed 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061659	0.998	ubiquitin-like protein ligase activity
GO:0061630	0.994	ubiquitin protein ligase activity
GO:0046914	0.456	transition metal ion binding
GO:0008270	0.435	zinc ion binding
GO:0042802	0.408	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0019538	0.981	protein metabolic process
GO:0050789	0.961	regulation of biological process
GO:0006508	0.959	proteolysis
GO:1901565	0.955	organonitrogen compound catabolic process
GO:0051603	0.947	proteolysis involved in protein catabolic process
GO:0071840	0.845	cellular component organization or biogenesis
GO:0044265	0.845	cellular macromolecule catabolic process
GO:0043632	0.844	modification-dependent macromolecule catabolic process
GO:0050794	0.827	regulation of cellular process
GO:0016043	0.808	cellular component organization
GO:0007154	0.727	cell communication
GO:0019941	0.674	modification-dependent protein catabolic process
GO:0006511	0.646	ubiquitin-dependent protein catabolic process
GO:0023052	0.636	signaling
GO:0048518	0.449	positive regulation of biological process
GO:0048522	0.436	positive regulation of cellular process
GO:0010498	0.428	proteasomal protein catabolic process
GO:0007267	0.387	cell-cell signaling
GO:0032502	0.313	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.993	endomembrane system
GO:0071944	0.988	cell periphery
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0005886	0.982	plasma membrane
GO:0031410	0.959	cytoplasmic vesicle
GO:0032991	0.881	protein-containing complex
GO:0005829	0.873	cytosol
GO:0005634	0.793	nucleus
GO:0140535	0.733	intracellular protein-containing complex
GO:1902494	0.596	catalytic complex
GO:0099503	0.517	secretory vesicle
GO:0000151	0.375	ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]