StarFunc result for job id Q8IUR6

User Input

>input (639 residues)
MPQPSVSGMDPPFGDAFRSHTFSEQTLMSTDLLANSSDPDFMYELDREMNYQQNPRDNFL
SLEDCKDIENLESFTDVLDNEGALTSNWEQWDTYCEDLTKYTKLTSCDIWGTKEVDYLGL
DDFSSPYQDEEVISKTPTLAQLNSEDSQSVSDSLYYPDSLFSVKQNPLPSSFPGKKITSR
AAAPVCSSKTLQAEVPLSDCVQKASKPTSSTQIMVKTNMYHNEKVNFHVECKDYVKKAKV
KINPVQQSRPLLSQIHTDAAKENTCYCGAVAKRQEKKGMEPLQGHATPALPFKETQELLL
SPLPQEGPGSLAAGESSSLSASTSVSDSSQKKEEHNYSLFVSDNLGEQPTKCSPEEDEED
EEDVDDEDHDEGFGSEHELSENEEEEEEEEDYEDDKDDDISDTFSEPGYENDSVEDLKEV
TSISSRKRGKRRYFWEYSEQLTPSQQERMLRPSEWNRDTLPSNMYQKNGLHHGKYAVKKS
RRTDVEDLTPNPKKLLQIGNELRKLNKVISDLTPVSELPLTARPRSRKEKNKLASRACRL
KKKAQYEANKVKLWGLNTEYDNLLFVINSIKQEIVNRVQNPRDERGPNMGQKLEILIKDT
LGLPVAGQTSEFVNQVLEKTAEGNPTGGLVGLRIPTSKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86IH1	0.069	0.062	2.307E-2	740	0.114	0.099	Q86IH1.pdb.gz	HBX4_DICDI Homeobox protein 4 OS=Dictyostelium discoideum OX=44689 GN=hbx4 PE=3 SV=1
2	AFDB:P06536	0.066	0.056	8.506E-2	795	0.117	0.094	P06536.pdb.gz	GCR_RAT Glucocorticoid receptor OS=Rattus norvegicus OX=10116 GN=Nr3c1 PE=1 SV=2
3	AFDB:A0A2R8Q781	0.094	0.089	2.031E-1	678	0.136	0.128	A0A2R8Q781.pdb.gz
4	AFDB:P12252	0.075	0.055	2.390E-1	1070	0.119	0.071	P12252.pdb.gz	PDE4B_DROME cAMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=dnc PE=1 SV=4
5	AFDB:A0A1D8PLL4	0.076	0.056	3.137E-1	1027	0.136	0.085	A0A1D8PLL4.pdb.gz	A0A1D8PLL4_CANAL Rgt1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RGT1 PE=4 SV=1
6	AFDB:P52890	0.062	0.068	3.312E-1	566	0.128	0.145	P52890.pdb.gz	ATF1_SCHPO Transcription factor atf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atf1 PE=1 SV=1
7	AFDB:Q54C61	0.067	0.052	5.706E-1	942	0.136	0.092	Q54C61.pdb.gz	Q54C61_DICDI Man1/Src1 C-terminal domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293138 PE=4 SV=1
8	AFDB:Q9FNM7	0.048	0.038	7.488E-1	850	0.081	0.061	Q9FNM7.pdb.gz	RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana OX=3702 GN=RH26 PE=1 SV=2
9	AFDB:Q587H5	0.107	0.048	7.907E-1	1501	0.138	0.059	Q587H5.pdb.gz	Q587H5_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=10C8.160 PE=4 SV=1
10	AFDB:Q54I36	0.076	0.041	8.349E-1	1338	0.100	0.048	Q54I36.pdb.gz	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
11	PDB:6n63A	0.079	0.303	1.078	141	0.039	0.177	6n63A.pdb.gz	Large protein organelles form a new iron sequestration system with high storage capacity.
12	PDB:7wfeBF	0.073	0.217	1.578	154	0.041	0.169	7wfeBF.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
13	PDB:5mymC	0.076	0.164	2.718	205	0.042	0.132	5mymC.pdb.gz	Target Identification of Mycobacterium tuberculosis Phenotypic Hits Using a Concerted Chemogenomic, Biophysical, and Structural Approach.
14	PDB:1tj7A	0.079	0.106	3.199	455	0.042	0.059	1tj7A.pdb.gz	Structure determination and refinement at 2.44 A resolution of argininosuccinate lyase from Escherichia coli.
15	PDB:3lsjA	0.062	0.142	3.766	205	0.038	0.117	3lsjA.pdb.gz	Structural basis for the transcriptional regulation of membrane lipid homeostasis.
16	PDB:7d6dA	0.085	0.133	3.766	380	0.023	0.039	7d6dA.pdb.gz
17	PDB:6b2za	0.070	0.145	3.977	249	0.020	0.052	6b2za.pdb.gz	Atomic model for the dimeric FO region of mitochondrial ATP synthase.
18	PDB:4kxrB	0.101	0.247	4.199	174	0.031	0.115	4kxrB.pdb.gz
19	PDB:7z0lB	0.074	0.118	4.434	370	0.019	0.032	7z0lB.pdb.gz
20	PDB:4k34B	0.076	0.126	4.681	351	0.041	0.074	4k34B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CDG5	0.0	1127	640	0.939	0.938	CRERF_MOUSE CREB3 regulatory factor OS=Mus musculus OX=10090 GN=Crebrf PE=2 SV=1
2	Q8IUR6	0.0	1318	639	1.000	1.000	CRERF_HUMAN CREB3 regulatory factor OS=Homo sapiens OX=9606 GN=CREBRF PE=1 SV=2
3	Q9VC61	2.95e-27	119	755	0.152	0.128	CRERF_DROME Protein CREBRF homolog OS=Drosophila melanogaster OX=7227 GN=REPTOR PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	1.8	20.1	bZIP transcription factor
2	PF07716 bZIP_2	19	16.8	Basic region leucine zipper

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296953

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342136	0.958	Cyclic AMP-responsive element-binding protein 3
2	9606.ENSP00000228865	0.874	cAMP-responsive element-binding protein-like 2
3	9606.ENSP00000429690	0.756	V-type proton ATPase subunit e 1
4	9606.ENSP00000357596	0.742	Cyclic AMP-responsive element-binding protein 3-like protein 4
5	9606.ENSP00000354775	0.640	E3 ubiquitin-protein ligase Praja-2
6	9606.ENSP00000231668	0.631	BCL2/adenovirus E1B 19kDa interacting protein 1
7	9606.ENSP00000379568	0.631	Acyl-CoA-binding domain-containing protein 5
8	9606.ENSP00000365007	0.630	DnaJ heat shock protein family member C16
9	9606.ENSP00000395012	0.627	Kelch-like protein 24
10	9606.ENSP00000155926	0.543	Tribbles homolog 2
11	9606.ENSP00000428205	0.543	F-box only protein 32
12	9606.ENSP00000340494	0.534	Zinc finger protein 395
13	9606.ENSP00000321546	0.510	BLOC-1-related complex subunit 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001216	1.000	DNA-binding transcription activator activity
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0000981	0.997	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.971	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.963	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.991	regulation of cellular process
GO:0080090	0.989	regulation of primary metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0010556	0.980	regulation of macromolecule biosynthetic process
GO:0031326	0.976	regulation of cellular biosynthetic process
GO:1903506	0.972	regulation of nucleic acid-templated transcription
GO:0009987	0.970	cellular process
GO:0048519	0.966	negative regulation of biological process
GO:0009893	0.966	positive regulation of metabolic process
GO:0023051	0.965	regulation of signaling
GO:0010646	0.964	regulation of cell communication
GO:0048583	0.963	regulation of response to stimulus
GO:0048522	0.956	positive regulation of cellular process
GO:0009966	0.954	regulation of signal transduction
GO:0048523	0.953	negative regulation of cellular process
GO:0010468	0.949	regulation of gene expression
GO:0006355	0.939	regulation of DNA-templated transcription
GO:0009968	0.920	negative regulation of signal transduction
GO:0080135	0.919	regulation of cellular response to stress
GO:1905897	0.848	regulation of response to endoplasmic reticulum stress
GO:0031325	0.829	positive regulation of cellular metabolic process
GO:0050896	0.822	response to stimulus
GO:0006357	0.793	regulation of transcription by RNA polymerase II
GO:0032879	0.788	regulation of localization
GO:0051173	0.775	positive regulation of nitrogen compound metabolic process
GO:0010604	0.740	positive regulation of macromolecule metabolic process
GO:0060341	0.721	regulation of cellular localization
GO:0031328	0.706	positive regulation of cellular biosynthetic process
GO:0010557	0.704	positive regulation of macromolecule biosynthetic process
GO:0051716	0.664	cellular response to stimulus
GO:1902680	0.599	positive regulation of RNA biosynthetic process
GO:0045893	0.590	positive regulation of DNA-templated transcription
GO:1900101	0.531	regulation of endoplasmic reticulum unfolded protein response
GO:0008152	0.497	metabolic process
GO:0009892	0.474	negative regulation of metabolic process
GO:0051049	0.455	regulation of transport
GO:0006950	0.448	response to stress
GO:0051050	0.421	positive regulation of transport
GO:0031324	0.416	negative regulation of cellular metabolic process
GO:0045934	0.414	negative regulation of nucleobase-containing compound metabolic process
GO:0033554	0.395	cellular response to stress
GO:0009894	0.389	regulation of catabolic process
GO:0051246	0.387	regulation of protein metabolic process
GO:0071704	0.384	organic substance metabolic process
GO:0034976	0.379	response to endoplasmic reticulum stress
GO:0051247	0.376	positive regulation of protein metabolic process
GO:0045944	0.367	positive regulation of transcription by RNA polymerase II
GO:0010558	0.366	negative regulation of macromolecule biosynthetic process
GO:1903573	0.361	negative regulation of response to endoplasmic reticulum stress
GO:0031327	0.339	negative regulation of cellular biosynthetic process
GO:0045892	0.331	negative regulation of DNA-templated transcription
GO:0032880	0.324	regulation of protein localization
GO:0032386	0.313	regulation of intracellular transport
GO:1903829	0.313	positive regulation of protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016604	1.000	nuclear body
GO:0005737	0.980	cytoplasm
GO:0016020	0.480	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]