StarFunc result for job id Q8IUX4

User Input

>input (373 residues)
MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYS
QPEHHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLAEHPNVTLTISAA
RLYYYWERDYRRALCRLSQAGARVKIMDDEEFAYCWENFVYSEGQPFMPWYKFDDNYAFL
HRTLKEILRNPMEAMYPHIFYFHFKNLRKAYGRNESWLCFTMEVVKHHSPVSWKRGVFRN
QVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLT
IFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYN
FLFLDSKLQEILE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IUX4	1.000	1.000	1.733E-85	373	1.000	1.000	Q8IUX4.pdb.gz	ABC3F_HUMAN DNA dC->dU-editing enzyme APOBEC-3F OS=Homo sapiens OX=9606 GN=APOBEC3F PE=1 SV=3
2	AFDB:Q96AK3	0.563	0.547	1.605E-68	386	0.799	0.772	Q96AK3.pdb.gz	ABC3D_HUMAN DNA dC->dU-editing enzyme APOBEC-3D OS=Homo sapiens OX=9606 GN=APOBEC3D PE=1 SV=1
3	AFDB:B0QYD3	0.529	0.409	2.430E-58	490	0.606	0.461	B0QYD3.pdb.gz	B0QYD3_HUMAN Apolipoprotein B mRNA editing enzyme catalytic subunit 3B OS=Homo sapiens OX=9606 GN=APOBEC3B PE=1 SV=1
4	AFDB:Q7YR24	0.533	0.522	1.624E-50	384	0.507	0.492	Q7YR24.pdb.gz	ABC3G_PANTR DNA dC->dU-editing enzyme APOBEC-3G OS=Pan troglodytes OX=9598 GN=APOBEC3G PE=1 SV=2
5	AFDB:Q7YR25	0.538	0.534	7.404E-48	377	0.461	0.456	Q7YR25.pdb.gz	ABC3G_CHLAE DNA dC->dU-editing enzyme APOBEC-3G (Fragment) OS=Chlorocebus aethiops OX=9534 GN=APOBEC3G PE=1 SV=1
6	AFDB:Q7YR23	0.548	0.553	4.022E-45	370	0.450	0.454	Q7YR23.pdb.gz	ABC3G_MACMU DNA dC->dU-editing enzyme APOBEC-3G (Fragment) OS=Macaca mulatta OX=9544 GN=APOBEC3G PE=1 SV=1
7	AFDB:Q99J72	0.463	0.394	4.274E-41	440	0.346	0.293	Q99J72.pdb.gz	ABEC3_MOUSE DNA dC->dU-editing enzyme APOBEC-3 OS=Mus musculus OX=10090 GN=Apobec3 PE=1 SV=3
8	AFDB:Q9NRW3	0.488	0.952	2.939E-34	190	0.391	0.768	Q9NRW3.pdb.gz	ABC3C_HUMAN DNA dC->dU-editing enzyme APOBEC-3C OS=Homo sapiens OX=9606 GN=APOBEC3C PE=1 SV=2
9	PDB:3vm8A	0.476	0.931	1.237E-29	187	0.391	0.781	3vm8A.pdb.gz	Crystal structure of the human APOBEC3C having HIV-1 Vif-binding interface
10	AFDB:Q4VDN5	0.479	0.916	1.750E-24	192	0.249	0.484	Q4VDN5.pdb.gz	AB3CA_FELCA DNA dC->dU-editing enzyme APOBEC-3Ca OS=Felis catus OX=9685 GN=APOBEC3CA PE=1 SV=1
11	AFDB:B3DGZ0	0.450	0.790	4.323E-23	210	0.193	0.343	B3DGZ0.pdb.gz
12	PDB:6x91H	0.390	0.271	4.637E-14	558	0.172	0.115	6x91H.pdb.gz	The structure of APOBEC1 and insights into its RNA and DNA substrate selectivity.
13	PDB:6b0bA	0.414	0.815	1.672E-13	180	0.172	0.356	6b0bA.pdb.gz	The Antiviral and Cancer Genomic DNA Deaminase APOBEC3H Is Regulated by an RNA-Mediated Dimerization Mechanism.
14	PDB:7d3vB	0.425	0.753	2.912E-12	199	0.198	0.372	7d3vB.pdb.gz	Non-specific and specific interactions work cooperatively to promote cytidine deamination catalyzed by APOBEC3
15	PDB:6x91A	0.409	0.268	8.318E-12	592	0.174	0.110	6x91A.pdb.gz	The structure of APOBEC1 and insights into its RNA and DNA substrate selectivity.
16	PDB:2w4lE	0.196	0.396	7.887E-4	162	0.043	0.099	2w4lE.pdb.gz	The Crystal Structure of Human Dcmp Deaminase
17	PDB:1ox7B	0.185	0.357	1.498E-3	161	0.056	0.130	1ox7B.pdb.gz	The 1.14 a crystal structure of yeast Cytosine deaminase. Evolution of nucleotide salvage enzymes and implications for genetic chemotherapy.
18	PDB:2w4lC	0.192	0.433	1.784E-3	142	0.046	0.120	2w4lC.pdb.gz	The Crystal Structure of Human Dcmp Deaminase
19	PDB:3g8qA	0.148	0.191	6.070E-3	278	0.072	0.097	3g8qA.pdb.gz	A cytidine deaminase edits C to U in transfer RNAs in Archaea
20	PDB:8aw32	0.146	0.264	1.948E-2	177	0.051	0.107	8aw32.pdb.gz	Structural basis for sequence-independent substrate selection by eukaryotic wobble base tRNA deaminase ADAT2/3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IUX4	0.0	784	373	1.000	1.000	ABC3F_HUMAN DNA dC->dU-editing enzyme APOBEC-3F OS=Homo sapiens OX=9606 GN=APOBEC3F PE=1 SV=3
2	Q96AK3	0.0	599	386	0.802	0.775	ABC3D_HUMAN DNA dC->dU-editing enzyme APOBEC-3D OS=Homo sapiens OX=9606 GN=APOBEC3D PE=1 SV=1
3	Q9UH17	1.79e-148	426	382	0.611	0.597	ABC3B_HUMAN DNA dC->dU-editing enzyme APOBEC-3B OS=Homo sapiens OX=9606 GN=APOBEC3B PE=1 SV=1
4	B0QYD3	4.34e-147	427	490	0.611	0.465	B0QYD3_HUMAN Apolipoprotein B mRNA editing enzyme catalytic subunit 3B OS=Homo sapiens OX=9606 GN=APOBEC3B PE=1 SV=1
5	Q9HC16	6.41e-119	351	384	0.520	0.505	ABC3G_HUMAN DNA dC->dU-editing enzyme APOBEC-3G OS=Homo sapiens OX=9606 GN=APOBEC3G PE=1 SV=1
6	Q7YR24	4.78e-113	336	384	0.504	0.490	ABC3G_PANTR DNA dC->dU-editing enzyme APOBEC-3G OS=Pan troglodytes OX=9598 GN=APOBEC3G PE=1 SV=2
7	Q9NRW3	1.36e-105	310	190	0.394	0.774	ABC3C_HUMAN DNA dC->dU-editing enzyme APOBEC-3C OS=Homo sapiens OX=9606 GN=APOBEC3C PE=1 SV=2
8	Q7YR25	3.30e-100	303	377	0.466	0.462	ABC3G_CHLAE DNA dC->dU-editing enzyme APOBEC-3G (Fragment) OS=Chlorocebus aethiops OX=9534 GN=APOBEC3G PE=1 SV=1
9	Q7YR23	2.21e-95	291	370	0.456	0.459	ABC3G_MACMU DNA dC->dU-editing enzyme APOBEC-3G (Fragment) OS=Macaca mulatta OX=9544 GN=APOBEC3G PE=1 SV=1
10	Q99J72	1.17e-57	195	440	0.346	0.293	ABEC3_MOUSE DNA dC->dU-editing enzyme APOBEC-3 OS=Mus musculus OX=10090 GN=Apobec3 PE=1 SV=3
11	Q4VDN5	2.54e-54	179	192	0.252	0.490	AB3CA_FELCA DNA dC->dU-editing enzyme APOBEC-3Ca OS=Felis catus OX=9685 GN=APOBEC3CA PE=1 SV=1
12	Q9WVE0	5.66e-40	142	198	0.209	0.394	AICDA_MOUSE Single-stranded DNA cytosine deaminase OS=Mus musculus OX=10090 GN=Aicda PE=1 SV=1
13	Q9GZX7	4.55e-39	140	198	0.204	0.384	AICDA_HUMAN Single-stranded DNA cytosine deaminase OS=Homo sapiens OX=9606 GN=AICDA PE=1 SV=1
14	Q5YF88	1.23e-35	131	210	0.196	0.348	Q5YF88_DANRE Activation-induced cytidine deaminase OS=Danio rerio OX=7955 GN=aicda PE=2 SV=1
15	A0A0K0MJ49	1.13e-32	123	199	0.204	0.382	A0A0K0MJ49_HUMAN APOBEC3A OS=Homo sapiens OX=9606 GN=APOBEC3A PE=2 SV=1
16	P31941	1.13e-32	123	199	0.204	0.382	ABC3A_HUMAN DNA dC->dU-editing enzyme APOBEC-3A OS=Homo sapiens OX=9606 GN=APOBEC3A PE=1 SV=3
17	Q9WV35	2.49e-29	115	224	0.155	0.259	ABEC2_MOUSE C->U-editing enzyme APOBEC-2 OS=Mus musculus OX=10090 GN=Apobec2 PE=1 SV=1
18	Q5CZQ2	4.72e-29	115	249	0.166	0.249	Q5CZQ2_DANRE Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2a OS=Danio rerio OX=7955 GN=zgc:110762 PE=1 SV=1
19	D2D565	9.23e-28	112	273	0.161	0.220	D2D565_DANRE Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2b OS=Danio rerio OX=7955 GN=apobec2b PE=2 SV=1
20	Q9Y235	3.52e-27	109	224	0.169	0.281	ABEC2_HUMAN C->U-editing enzyme APOBEC-2 OS=Homo sapiens OX=9606 GN=APOBEC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18767 AID	2.2e-09	48.5	Activation induced deaminase
2	PF18769 APOBEC1	5.9e-40	146.8	APOBEC1
3	PF18772 APOBEC2	2.6e-141	478.6	APOBEC2
4	PF18771 APOBEC3	7.9e-66	231.7	APOBEC3
5	PF18775 APOBEC4	2.3e-40	147.9	APOBEC4
6	PF18774 APOBEC4_like	1.5e-51	185.3	APOBEC4-like -AID/APOBEC-deaminase
7	PF05240 APOBEC_C	9.6e-64	222.8	APOBEC-like C-terminal domain
8	PF08210 APOBEC_N	1.2e-102	352.8	APOBEC-like N-terminal domain
9	PF00383 dCMP_cyt_deam_1	0.00026	32.2	Cytidine and deoxycytidylate deaminase zinc-binding region
10	PF07527 Hairy_orange	1.1e+02	14.5	Hairy Orange
11	PF17921 Integrase_H2C2	1.4e+02	14.0	Integrase zinc binding domain
12	PF14437 MafB19-deam	3.4e+02	12.4	MafB19-like deaminase
13	PF18778 NAD1	9.4e-119	405.3	Novel AID APOBEC clade 1
14	PF18782 NAD2	6.1e-151	510.4	Novel AID APOBEC clade 2
15	PF18750 SNAD4	1.2e-81	281.8	Secreted Novel AID/APOBEC-like Deaminase 4
16	PF14424 Toxin-deaminase	0.11	24.0	The BURPS668_1122 family of deaminases

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309749

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376808	0.935	Cullin-5
2	9606.ENSP00000262306	0.912	Elongin-B
3	9606.ENSP00000478121	0.885	Elongin-C
4	9606.ENSP00000273480	0.876	RING-box protein 2
5	9606.ENSP00000358490	0.835	T-cell surface antigen CD2
6	9606.ENSP00000310622	0.834	Putative C->U-editing enzyme APOBEC-4
7	9606.ENSP00000378868	0.830	APOBEC1 complementation factor
8	9606.ENSP00000385057	0.826	DNA dC->dU-editing enzyme APOBEC-3G
9	9606.ENSP00000258424	0.796	Cytochrome c oxidase subunit 5B, mitochondrial
10	9606.ENSP00000317159	0.771	Cytochrome c1, heme protein, mitochondrial
11	9606.ENSP00000306397	0.752	Cytochrome b-c1 complex subunit Rieske, mitochondrial
12	9606.ENSP00000317780	0.725	Cytochrome c oxidase subunit 5A, mitochondrial
13	9606.ENSP00000268379	0.713	Cytochrome b-c1 complex subunit 2, mitochondrial
14	9606.ENSP00000369373	0.712	Tripartite motif-containing protein 5
15	9606.ENSP00000252593	0.695	Bone marrow stromal antigen 2
16	9606.ENSP00000364212	0.688	Cytidine deaminase
17	9606.ENSP00000215375	0.677	ATP synthase subunit delta, mitochondrial
18	9606.ENSP00000297071	0.668	Transformer-2 protein homolog alpha
19	9606.ENSP00000262878	0.645	Deoxynucleoside triphosphate triphosphohydrolase SAMHD1
20	9606.ENSP00000367939	0.636	Cytochrome b-c1 complex subunit 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0004126	1.000	cytidine deaminase activity
GO:0046872	0.994	metal ion binding
GO:0046914	0.956	transition metal ion binding
GO:0008270	0.951	zinc ion binding
GO:0042802	0.945	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.986	cellular metabolic process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0048525	0.977	negative regulation of viral process
GO:0045069	0.977	regulation of viral genome replication
GO:0048523	0.969	negative regulation of cellular process
GO:0006952	0.960	defense response
GO:0010528	0.959	regulation of transposition
GO:0045071	0.947	negative regulation of viral genome replication
GO:0010529	0.945	negative regulation of transposition
GO:0071704	0.926	organic substance metabolic process
GO:0044238	0.918	primary metabolic process
GO:0051607	0.916	defense response to virus
GO:0006304	0.895	DNA modification
GO:0019222	0.844	regulation of metabolic process
GO:0060255	0.807	regulation of macromolecule metabolic process
GO:0031323	0.760	regulation of cellular metabolic process
GO:0051171	0.718	regulation of nitrogen compound metabolic process
GO:0080090	0.716	regulation of primary metabolic process
GO:0019219	0.684	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.659	regulation of macromolecule biosynthetic process
GO:0031326	0.659	regulation of cellular biosynthetic process
GO:0009892	0.648	negative regulation of metabolic process
GO:2001141	0.646	regulation of RNA biosynthetic process
GO:0031324	0.495	negative regulation of cellular metabolic process
GO:0051172	0.494	negative regulation of nitrogen compound metabolic process
GO:0010605	0.489	negative regulation of macromolecule metabolic process
GO:1902679	0.464	negative regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005634	0.993	nucleus
GO:0032991	0.990	protein-containing complex
GO:0043232	0.986	intracellular non-membrane-bounded organelle
GO:0000932	0.980	P-body
GO:1902494	0.883	catalytic complex
GO:0016020	0.564	membrane
GO:0045293	0.547	mRNA editing complex
GO:1990904	0.381	ribonucleoprotein complex
GO:0070013	0.378	intracellular organelle lumen
GO:0031981	0.340	nuclear lumen
GO:0005654	0.313	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16069	1.000	cytidine + H(+) + H2O = NH4(+) + uridine
EC:3.5.4.5	1.000	cytidine deaminase.

[back to server]