StarFunc result for job id Q8IUX7

User Input

>input (1158 residues)
MAAVRGAPLLSCLLALLALCPGGRPQTVLTDDEIEEFLEGFLSELEPEPREDDVEAPPPP
EPTPRVRKAQAGGKPGKRPGTAAEVPPEKTKDKGKKGKKDKGPKVPKESLEGSPRPPKKG
KEKPPKATKKPKEKPPKATKKPKEKPPKATKKPKEKPPKATKKPPSGKRPPILAPSETLE
WPLPPPPSPGPEELPQEGGAPLSNNWQNPGEETHVEAREHQPEPEEETEQPTLDYNDQIE
REDYEDFEYIRRQKQPRPPPSRRRRPERVWPEPPEEKAPAPAPEERIEPPVKPLLPPLPP
DYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPKEETDKWAVEK
GKDHKEPRKGEELEEEWTPTEKVKCPPIGMESHRIEDNQIRASSMLRHGLGAQRGRLNMQ
TGATEDDYYDGAWCAEDDARTQWIEVDTRRTTRFTGVITQGRDSSIHDDFVTTFFVGFSN
DSQTWVMYTNGYEEMTFHGNVDKDTPVLSELPEPVVARFIRIYPLTWNGSLCMRLEVLGC
SVAPVYSYYAQNEVVATDDLDFRHHSYKDMRQLMKVVNEECPTITRTYSLGKSSRGLKIY
AMEISDNPGEHELGEPEFRYTAGIHGNEVLGRELLLLLMQYLCREYRDGNPRVRSLVQDT
RIHLVPSLNPDGYEVAAQMGSEFGNWALGLWTEEGFDIFEDFPDLNSVLWGAEERKWVPY
RVPNNNLPIPERYLSPDATVSTEVRAIIAWMEKNPFVLGANLNGGERLVSYPYDMARTPT
QEQLLAAAMAAARGEDEDEVSEAQETPDHAIFRWLAISFASAHLTLTEPYRGGCQAQDYT
GGMGIVNGAKWNPRTGTINDFSYLHTNCLELSFYLGCDKFPHESELPREWENNKEALLTF
MEQVHRGIKGVVTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGY
TPSAKTCNVDYDIGATQCNFILARSNWKRIREIMAMNGNRPIPHIDPSRPMTPQQRRLQQ
RRLQHRLRLRAQMRLRRLNATTTLGPHTVPPTLPPAPATTLSTTIEPWGLIPPTTAGWEE
SETETYTEVVTEFGTEVEPEFGTKVEPEFETQLEPEFETQLEPEFEEEEEEEKEEEIATG
QAFPFTTVETYTVNFGDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q640N1	0.653	0.670	0.000	1128	0.830	0.852	Q640N1.pdb.gz	AEBP1_MOUSE Adipocyte enhancer-binding protein 1 OS=Mus musculus OX=10090 GN=Aebp1 PE=1 SV=1
2	AFDB:Q8IUX7	1.000	1.000	0.000	1158	1.000	1.000	Q8IUX7.pdb.gz	AEBP1_HUMAN Adipocyte enhancer-binding protein 1 OS=Homo sapiens OX=9606 GN=AEBP1 PE=1 SV=1
3	PDB:2nsmA	0.324	0.949	7.708E-51	390	0.164	0.487	2nsmA.pdb.gz
4	PDB:1h8lA	0.306	0.909	9.338E-47	380	0.153	0.466	1h8lA.pdb.gz	The crystal structure of the inhibitor-complexed carboxypeptidase D domain II and the modeling of regulatory carboxypeptidases.
5	PDB:1uwyA	0.308	0.884	5.632E-37	393	0.106	0.313	1uwyA.pdb.gz	Crystal Structure of Human Carboxypeptidase M, a Membrane-Bound Enzyme that Regulates Peptide Hormone Activity
6	PDB:1kwmA	0.216	0.580	3.233E-16	402	0.058	0.167	1kwmA.pdb.gz	Human procarboxypeptidase B: three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (TAFI).
7	PDB:5mrvA	0.211	0.743	9.423E-16	307	0.044	0.166	5mrvA.pdb.gz	Crystal structure and mechanism of human carboxypeptidase O: Insights into its specific activity for acidic residues.
8	PDB:1ayeA	0.210	0.565	1.564E-15	401	0.055	0.160	1ayeA.pdb.gz	The three-dimensional structure of human procarboxypeptidase A2. Deciphering the basis of the inhibition, activation and intrinsic activity of the zymogen.
9	PDB:4bxsV	0.128	0.118	6.800E-14	1262	0.050	0.046	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
10	PDB:4p10A	0.220	0.590	4.878E-13	402	0.054	0.157	4p10A.pdb.gz	Design and synthesis of conformationally restricted inhibitors of active thrombin activatable fibrinolysis inhibitor (TAFIa).
11	PDB:7kveB	0.130	0.112	1.270E-12	1374	0.050	0.042	7kveB.pdb.gz
12	PDB:2vmeA	0.118	0.498	2.794E-12	256	0.040	0.180	2vmeA.pdb.gz	Structure Determination of Discoidin II from Dictyostelium Discoideum and Carbohydrate Binding Properties of the Lectin Domain.
13	AFDB:P12259	0.139	0.076	2.033E-7	2224	0.054	0.028	P12259.pdb.gz	FA5_HUMAN Coagulation factor V OS=Homo sapiens OX=9606 GN=F5 PE=1 SV=4
14	AFDB:Q04164	0.039	0.031	2.092E-2	1693	0.073	0.050	Q04164.pdb.gz	SAS_DROME Putative epidermal cell surface receptor OS=Drosophila melanogaster OX=7227 GN=sas PE=2 SV=2
15	AFDB:Q59IW6	0.044	0.044	2.477E-2	1179	0.098	0.097	Q59IW6.pdb.gz	Q59IW6_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
16	AFDB:Q9USR9	0.050	0.077	2.477E-2	643	0.065	0.117	Q9USR9.pdb.gz	CENPC_SCHPO Inner kinetochore subunit cnp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnp3 PE=1 SV=2
17	AFDB:D4A0I8	0.075	0.086	5.764E-2	931	0.076	0.095	D4A0I8.pdb.gz	D4A0I8_RAT Nuclear factor of activated T-cells 2 OS=Rattus norvegicus OX=10116 GN=Nfatc2 PE=1 SV=1
18	AFDB:A0A0G2K7A5	0.043	0.060	6.451E-2	680	0.082	0.140	A0A0G2K7A5.pdb.gz	A0A0G2K7A5_RAT Collagen type X alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col10a1 PE=4 SV=1
19	AFDB:Q5VT97	0.050	0.048	6.451E-2	1194	0.074	0.072	Q5VT97.pdb.gz	SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens OX=9606 GN=SYDE2 PE=1 SV=2
20	AFDB:Q03692	0.050	0.070	1.012E-1	680	0.090	0.153	Q03692.pdb.gz	COAA1_HUMAN Collagen alpha-1(X) chain OS=Homo sapiens OX=9606 GN=COL10A1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q640N1	0.0	1583	1128	0.830	0.852	AEBP1_MOUSE Adipocyte enhancer-binding protein 1 OS=Mus musculus OX=10090 GN=Aebp1 PE=1 SV=1
2	Q8IUX7	0.0	2371	1158	1.000	1.000	AEBP1_HUMAN Adipocyte enhancer-binding protein 1 OS=Homo sapiens OX=9606 GN=AEBP1 PE=1 SV=1
3	Q9Z100	0.0	659	722	0.284	0.456	CPXM1_MOUSE Probable carboxypeptidase X1 OS=Mus musculus OX=10090 GN=Cpxm1 PE=2 SV=2
4	Q6NY94	7.54e-113	361	450	0.166	0.427	Q6NY94_DANRE Carboxypeptidase N catalytic chain precursor OS=Danio rerio OX=7955 GN=fa99g08 PE=2 SV=1
5	P15169	1.69e-108	349	458	0.174	0.439	CBPN_HUMAN Carboxypeptidase N catalytic chain OS=Homo sapiens OX=9606 GN=CPN1 PE=1 SV=1
6	Q9EQV8	4.45e-106	343	457	0.158	0.400	CBPN_RAT Carboxypeptidase N catalytic chain OS=Rattus norvegicus OX=10116 GN=Cpn1 PE=2 SV=1
7	Q9JJN5	9.27e-106	342	457	0.159	0.403	CBPN_MOUSE Carboxypeptidase N catalytic chain OS=Mus musculus OX=10090 GN=Cpn1 PE=1 SV=1
8	Q00493	7.51e-105	340	476	0.148	0.359	CBPE_MOUSE Carboxypeptidase E OS=Mus musculus OX=10090 GN=Cpe PE=1 SV=2
9	P16870	9.04e-105	340	476	0.148	0.359	CBPE_HUMAN Carboxypeptidase E OS=Homo sapiens OX=9606 GN=CPE PE=1 SV=1
10	P15087	2.59e-104	339	476	0.148	0.359	CBPE_RAT Carboxypeptidase E OS=Rattus norvegicus OX=10116 GN=Cpe PE=1 SV=1
11	Q66K79	5.12e-104	344	652	0.155	0.275	CBPZ_HUMAN Carboxypeptidase Z OS=Homo sapiens OX=9606 GN=CPZ PE=1 SV=2
12	Q8R4V4	1.67e-102	340	654	0.152	0.269	CBPZ_MOUSE Carboxypeptidase Z OS=Mus musculus OX=10090 GN=Cpz PE=2 SV=2
13	P83852	1.01e-95	312	380	0.155	0.471	CBPD_LOPSP Carboxypeptidase D (Fragment) OS=Lophonetta specularioides OX=75873 GN=CPD PE=1 SV=1
14	Q9JHW1	3.36e-89	317	1378	0.154	0.129	CBPD_RAT Carboxypeptidase D OS=Rattus norvegicus OX=10116 GN=Cpd PE=1 SV=2
15	Q90240	2.75e-88	315	1389	0.158	0.132	CBPD_ANAPL Carboxypeptidase D OS=Anas platyrhynchos OX=8839 GN=CPD PE=1 SV=1
16	O75976	5.05e-88	314	1380	0.151	0.127	CBPD_HUMAN Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD PE=1 SV=2
17	O17754	4.51e-68	239	472	0.124	0.305	CBPE_CAEEL Carboxypeptidase E OS=Caenorhabditis elegans OX=6239 GN=egl-21 PE=1 SV=1
18	P42787	5.83e-68	253	1406	0.123	0.102	CBPD_DROME Carboxypeptidase D OS=Drosophila melanogaster OX=7227 GN=svr PE=1 SV=2
19	Q22825	3.43e-62	223	492	0.123	0.289	Q22825_CAEEL Peptidase M14 carboxypeptidase A domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cpd-2 PE=1 SV=3
20	P14384	2.51e-60	216	443	0.121	0.316	CBPM_HUMAN Carboxypeptidase M OS=Homo sapiens OX=9606 GN=CPM PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13715 CarbopepD_reg_2	0.0017	29.7	CarboxypepD_reg-like domain
2	PF13620 CarboxypepD_reg	4.8e-11	54.1	Carboxypeptidase regulatory-like domain
3	PF00754 F5_F8_type_C	4.9e-22	89.8	F5/8 type C domain
4	PF08308 PEGA	3.2e+02	12.7	PEGA domain
5	PF00246 Peptidase_M14	2.8e-63	226.0	Zinc carboxypeptidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000223357

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000338512	0.718	Cytosolic carboxypeptidase 1
2	9606.ENSP00000297770	0.703	Carboxypeptidase A6
3	9606.ENSP00000262965	0.692	Transcription factor E2-alpha
4	9606.ENSP00000417222	0.646	M14 carboxypeptidases
5	9606.ENSP00000341680	0.633	Dysbindin
6	9606.ENSP00000245957	0.617	Cilia- and flagella-associated protein 61
7	9606.ENSP00000456850	0.614	Testicular haploid expressed gene protein-like
8	9606.ENSP00000347626	0.607	NudC domain containing 3
9	9606.ENSP00000386357	0.602	Leucine-rich repeat transmembrane neuronal protein 4
10	9606.ENSP00000223364	0.599	Myosin regulatory light chain 2, atrial isoform
11	9606.ENSP00000480186	0.597	DNA polymerase delta subunit 2
12	9606.ENSP00000243918	0.585	Protein SYS1 homolog
13	9606.ENSP00000355751	0.577	Thrombospondin-2
14	9606.ENSP00000297268	0.576	Collagen alpha-2(I) chain
15	9606.ENSP00000263080	0.569	Aspartoacylase
16	9606.ENSP00000216797	0.559	NF-kappa-B inhibitor alpha
17	9606.ENSP00000300527	0.559	Collagen alpha-2(VI) chain
18	9606.ENSP00000361811	0.538	TP53-target gene 5 protein
19	9606.ENSP00000369071	0.514	Periostin
20	9606.ENSP00000249700	0.507	Tropomodulin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0044877	0.995	protein-containing complex binding
GO:0005518	0.994	collagen binding
GO:0140110	0.990	transcription regulator activity
GO:0001217	0.979	DNA-binding transcription repressor activity
GO:0001227	0.969	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003824	0.948	catalytic activity
GO:0140096	0.921	catalytic activity, acting on a protein
GO:0016787	0.874	hydrolase activity
GO:0004180	0.832	carboxypeptidase activity
GO:0005515	0.661	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0048523	0.955	negative regulation of cellular process
GO:0080090	0.883	regulation of primary metabolic process
GO:0051171	0.879	regulation of nitrogen compound metabolic process
GO:0060255	0.870	regulation of macromolecule metabolic process
GO:0010605	0.863	negative regulation of macromolecule metabolic process
GO:1903053	0.852	regulation of extracellular matrix organization
GO:0045892	0.796	negative regulation of DNA-templated transcription
GO:1902903	0.578	regulation of supramolecular fiber organization
GO:0006357	0.558	regulation of transcription by RNA polymerase II
GO:0071704	0.509	organic substance metabolic process
GO:0000122	0.477	negative regulation of transcription by RNA polymerase II
GO:0044238	0.472	primary metabolic process
GO:0006807	0.471	nitrogen compound metabolic process
GO:0009987	0.466	cellular process
GO:0043170	0.431	macromolecule metabolic process
GO:1901564	0.383	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0071944	0.995	cell periphery
GO:0043227	0.969	membrane-bounded organelle
GO:0030312	0.969	external encapsulating structure
GO:0031012	0.878	extracellular matrix
GO:0070062	0.868	extracellular exosome
GO:0062023	0.815	collagen-containing extracellular matrix
GO:0005622	0.693	intracellular anatomical structure
GO:0005737	0.657	cytoplasm
GO:0043229	0.565	intracellular organelle
GO:0043231	0.372	intracellular membrane-bounded organelle
GO:0016020	0.343	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.874	Hydrolases.
RHEA:28783	0.832	H2O + L-cysteinylglycine = glycine + L-cysteine

[back to server]