StarFunc result for job id Q8IUX8

User Input

>input (553 residues)
MPLPWSLALPLLLSWVAGGFGNAASARHHGLLASARQPGVCHYGTKLACCYGWRRNSKGV
CEATCEPGCKFGECVGPNKCRCFPGYTGKTCSQDVNECGMKPRPCQHRCVNTHGSYKCFC
LSGHMLMPDATCVNSRTCAMINCQYSCEDTEEGPQCLCPSSGLRLAPNGRDCLDIDECAS
GKVICPYNRRCVNTFGSYYCKCHIGFELQYISGRYDCIDINECTMDSHTCSHHANCFNTQ
GSFKCKCKQGYKGNGLRCSAIPENSVKEVLRAPGTIKDRIKKLLAHKNSMKKKAKIKNVT
PEPTRTPTPKVNLQPFNYEEIVSRGGNSHGGKKGNEEKMKEGLEDEKREEKALKNDIEER
SLRGDVFFPKVNEAGEFGLILVQRKALTSKLEHKDLNISVDCSFNHGICDWKQDREDDFD
WNPADRDNAIGFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRV
FVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLLV
SGLCPDSLLSVDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IUX8	1.000	1.000	1.677E-101	553	1.000	1.000	Q8IUX8.pdb.gz	EGFL6_HUMAN Epidermal growth factor-like protein 6 OS=Homo sapiens OX=9606 GN=EGFL6 PE=1 SV=1
2	AFDB:Q6DHG1	0.348	0.375	1.190E-53	508	0.394	0.429	Q6DHG1.pdb.gz	Q6DHG1_DANRE EGF-like-domain, multiple 6 OS=Danio rerio OX=7955 GN=sb:cb3 PE=2 SV=1
3	AFDB:Q91V88	0.253	0.250	1.587E-48	561	0.374	0.369	Q91V88.pdb.gz	NPNT_MOUSE Nephronectin OS=Mus musculus OX=10090 GN=Npnt PE=1 SV=1
4	AFDB:Q6UXI9	0.258	0.253	6.404E-48	565	0.382	0.373	Q6UXI9.pdb.gz	NPNT_HUMAN Nephronectin OS=Homo sapiens OX=9606 GN=NPNT PE=2 SV=3
5	AFDB:H2DL88	0.235	0.206	7.552E-47	633	0.385	0.336	H2DL88.pdb.gz
6	AFDB:Q96DN2	0.171	0.106	4.531E-14	955	0.165	0.095	Q96DN2.pdb.gz	VWCE_HUMAN von Willebrand factor C and EGF domain-containing protein OS=Homo sapiens OX=9606 GN=VWCE PE=1 SV=2
7	AFDB:F1NWN4	0.157	0.078	6.623E-13	1196	0.159	0.074	F1NWN4.pdb.gz
8	AFDB:Q7Z304	0.248	0.202	8.766E-10	686	0.071	0.057	Q7Z304.pdb.gz	MAMC2_HUMAN MAM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAMDC2 PE=1 SV=3
9	AFDB:O35375	0.224	0.138	1.146E-9	931	0.085	0.050	O35375.pdb.gz	NRP2_MOUSE Neuropilin-2 OS=Mus musculus OX=10090 GN=Nrp2 PE=1 SV=2
10	AFDB:Q8K2T3	0.249	0.295	6.405E-8	461	0.087	0.104	Q8K2T3.pdb.gz	Q8K2T3_MOUSE Nrp2 protein (Fragment) OS=Mus musculus OX=10090 GN=Nrp2 PE=2 SV=1
11	PDB:7q3nU	0.138	0.230	6.614E-7	292	0.087	0.164	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:2e31A	0.154	0.297	2.970E-6	246	0.045	0.102	2e31A.pdb.gz
13	PDB:3wsoA	0.191	0.368	2.406E-5	252	0.038	0.083	3wsoA.pdb.gz
14	PDB:6vlsD	0.162	0.099	2.290E-4	963	0.038	0.022	6vlsD.pdb.gz
15	PDB:7qe7L	0.145	0.357	5.401E-4	183	0.031	0.093	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
16	PDB:4pxqA	0.153	0.163	6.013E-4	516	0.033	0.035	4pxqA.pdb.gz	Structural and Functional Study of d-Glucuronyl C5-epimerase.
17	PDB:7ungXA	0.166	0.396	7.063E-4	186	0.025	0.075	7ungXA.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
18	PDB:5e7gA	0.174	0.208	1.085E-3	446	0.040	0.049	5e7gA.pdb.gz	Molecular Dissection of Xyloglucan Recognition in a Prominent Human Gut Symbiont.
19	PDB:2waaA	0.151	0.232	1.344E-3	335	0.031	0.051	2waaA.pdb.gz
20	PDB:7drtB	0.119	0.131	1.579E-3	496	0.029	0.032	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IUX8	0.0	1147	553	1.000	1.000	EGFL6_HUMAN Epidermal growth factor-like protein 6 OS=Homo sapiens OX=9606 GN=EGFL6 PE=1 SV=1
2	Q9JJZ5	0.0	874	550	0.779	0.784	EGFL6_MOUSE Epidermal growth factor-like protein 6 OS=Mus musculus OX=10090 GN=Egfl6 PE=1 SV=1
3	Q6DHG1	4.19e-167	486	508	0.436	0.474	Q6DHG1_DANRE EGF-like-domain, multiple 6 OS=Danio rerio OX=7955 GN=sb:cb3 PE=2 SV=1
4	Q91V88	5.38e-100	315	561	0.253	0.250	NPNT_MOUSE Nephronectin OS=Mus musculus OX=10090 GN=Npnt PE=1 SV=1
5	Q6UXI9	6.07e-100	315	565	0.251	0.246	NPNT_HUMAN Nephronectin OS=Homo sapiens OX=9606 GN=NPNT PE=2 SV=3
6	B8A5G4	2.46e-97	310	605	0.248	0.226	B8A5G4_DANRE Nephronectin a OS=Danio rerio OX=7955 GN=POEM PE=3 SV=1
7	P37889	1.53e-26	117	1221	0.154	0.070	FBLN2_MOUSE Fibulin-2 OS=Mus musculus OX=10090 GN=Fbln2 PE=1 SV=2
8	A0A0G2KQ62	5.72e-26	115	2868	0.175	0.034	A0A0G2KQ62_DANRE Fibrillin 2b OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=2
9	B6CS38	5.93e-26	115	2868	0.175	0.034	B6CS38_DANRE Fibrillin 2 OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=1
10	Q61555	1.63e-25	114	2907	0.136	0.026	FBN2_MOUSE Fibrillin-2 OS=Mus musculus OX=10090 GN=Fbn2 PE=1 SV=2
11	P35556	1.73e-25	114	2912	0.137	0.026	FBN2_HUMAN Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3
12	F1SPG5	4.46e-25	112	1221	0.156	0.070	F1SPG5_PIG Fibulin 2 OS=Sus scrofa OX=9823 GN=FBLN2 PE=1 SV=3
13	D3YXG0	2.13e-24	110	5634	0.150	0.015	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
14	P98095	4.65e-24	109	1184	0.152	0.071	FBLN2_HUMAN Fibulin-2 OS=Homo sapiens OX=9606 GN=FBLN2 PE=1 SV=2
15	Q8N2S1	8.00e-24	108	1624	0.145	0.049	LTBP4_HUMAN Latent-transforming growth factor beta-binding protein 4 OS=Homo sapiens OX=9606 GN=LTBP4 PE=1 SV=2
16	Q96RW7	9.71e-24	108	5635	0.150	0.015	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
17	P98133	3.68e-23	107	2871	0.141	0.027	FBN1_BOVIN Fibrillin-1 OS=Bos taurus OX=9913 GN=FBN1 PE=1 SV=2
18	A0A8I6G7Y9	5.63e-23	106	2861	0.141	0.027	A0A8I6G7Y9_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
19	Q9WUH8	5.89e-23	106	2872	0.141	0.027	Q9WUH8_RAT Fibrillin-1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=2 SV=1
20	A0A8I6A897	6.19e-23	106	2813	0.141	0.028	A0A8I6A897_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	2.4e-13	61.0	Complement Clr-like EGF-like
2	PF02363 C_tripleX	1.4e+02	14.1	Cysteine rich repeat
3	PF00008 EGF	4.3e-05	35.0	EGF-like domain
4	PF07974 EGF_2	71	15.2	EGF-like domain
5	PF12947 EGF_3	1.8e-07	42.5	EGF domain
6	PF07645 EGF_CA	5e-19	79.5	Calcium-binding EGF domain
7	PF12946 EGF_MSP1_1	0.0044	28.3	MSP1 EGF domain 1
8	PF14670 FXa_inhibition	8.9e-07	40.4	Coagulation Factor Xa inhibitory site
9	PF12661 hEGF	2.4	20.1	Human growth factor-like EGF
10	PF00629 MAM	7.1e-19	79.6	MAM domain, meprin/A5/mu

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369976

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363040	0.764	Multiple epidermal growth factor-like domains protein 9
2	9606.ENSP00000414635	0.630	Leucine-rich repeat-containing protein 34
3	9606.ENSP00000296776	0.593	Transmembrane protein 174
4	9606.ENSP00000280481	0.538	FRAS1-related extracellular matrix protein 2
5	9606.ENSP00000366582	0.530	Protein FAM196B
6	9606.ENSP00000271332	0.518	Cadherin EGF LAG seven-pass G-type receptor 2
7	9606.ENSP00000366058	0.503	Synapse differentiation-inducing gene protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005178	0.999	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0048518	0.885	positive regulation of biological process
GO:0048522	0.873	positive regulation of cellular process
GO:0032502	0.807	developmental process
GO:0048856	0.797	anatomical structure development
GO:0007275	0.781	multicellular organism development
GO:0045785	0.740	positive regulation of cell adhesion
GO:0010810	0.735	regulation of cell-substrate adhesion
GO:0071840	0.465	cellular component organization or biogenesis
GO:0010811	0.450	positive regulation of cell-substrate adhesion
GO:0048583	0.418	regulation of response to stimulus
GO:0050896	0.403	response to stimulus
GO:0048731	0.386	system development
GO:0009966	0.371	regulation of signal transduction
GO:0016043	0.369	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.998	cellular anatomical entity
GO:0071944	0.992	cell periphery
GO:0005576	0.979	extracellular region
GO:0005615	0.930	extracellular space
GO:0031012	0.900	extracellular matrix
GO:0062023	0.877	collagen-containing extracellular matrix
GO:0043226	0.832	organelle
GO:0043227	0.744	membrane-bounded organelle
GO:0005622	0.688	intracellular anatomical structure
GO:0005737	0.627	cytoplasm
GO:0016020	0.362	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]