StarFunc result for job id Q8IUZ5

User Input

>input (450 residues)
MAADQRPKADTLALRQRLISSSCRLFFPEDPVKIVRAQGQYMYDEQGAEYIDCISNVAHV
GHCHPLVVQAAHEQNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSGSEANDLA
LRLARHYTGHQDVVVLDHAYHGHLSSLIDISPYKFRNLDGQKEWVHVAPLPDTYRGPYRE
DHPNPAMAYANEVKRVVSSAQEKGRKIAAFFAESLPSVGGQIIPPAGYFSQVAEHIRKAG
GVFVADEIQVGFGRVGKHFWAFQLQGKDFVPDIVTMGKSIGNGHPVACVAATQPVARAFE
ATGVEYFNTFGGSPVSCAVGLAVLNVLEKEQLQDHATSVGSFLMQLLGQQKIKHPIVGDV
RGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLD
NARQVVAKLDAILTDMEEKVRSCETLRLQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IUZ5	1.000	1.000	5.231E-92	450	1.000	1.000	Q8IUZ5.pdb.gz	AT2L2_HUMAN 5-phosphohydroxy-L-lysine phospho-lyase OS=Homo sapiens OX=9606 GN=PHYKPL PE=1 SV=1
2	AFDB:Q8R1K4	0.983	0.947	4.529E-82	467	0.869	0.837	Q8R1K4.pdb.gz	AT2L2_MOUSE 5-phosphohydroxy-L-lysine phospho-lyase OS=Mus musculus OX=10090 GN=Phykpl PE=1 SV=1
3	AFDB:Q8TBG4	0.970	0.875	2.136E-69	499	0.638	0.575	Q8TBG4.pdb.gz	AT2L1_HUMAN Ethanolamine-phosphate phospho-lyase OS=Homo sapiens OX=9606 GN=ETNPPL PE=1 SV=1
4	AFDB:Q7SY54	0.976	0.893	3.580E-68	492	0.622	0.569	Q7SY54.pdb.gz	AT2L1_DANRE Ethanolamine-phosphate phospho-lyase OS=Danio rerio OX=7955 GN=etnppl PE=2 SV=1
5	AFDB:Q9VU95	0.954	0.870	1.303E-60	494	0.496	0.451	Q9VU95.pdb.gz	AGT2L_DROME Alanine--glyoxylate aminotransferase 2-like OS=Drosophila melanogaster OX=7227 GN=CG8745 PE=2 SV=2
6	PDB:6torB	0.880	0.980	1.710E-60	404	0.598	0.666	6torB.pdb.gz	Structural characterization of human O-phosphoethanolamine phospho-lyase.
7	AFDB:Q940M2	0.902	0.854	2.835E-48	476	0.391	0.370	Q940M2.pdb.gz	AGT21_ARATH Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AGT2 PE=1 SV=1
8	AFDB:Q9SR86	0.895	0.838	4.253E-47	481	0.382	0.358	Q9SR86.pdb.gz	AGT23_ARATH Alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g08860 PE=2 SV=1
9	AFDB:Q94AL9	0.899	0.850	1.927E-45	477	0.382	0.361	Q94AL9.pdb.gz	AGT22_ARATH Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AGT3 PE=1 SV=2
10	AFDB:Q3UEG6	0.898	0.791	4.499E-44	513	0.324	0.285	Q3UEG6.pdb.gz	AGT2_MOUSE Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Agxt2 PE=1 SV=1
11	AFDB:Q9BYV1	0.895	0.786	1.546E-42	514	0.331	0.290	Q9BYV1.pdb.gz	AGT2_HUMAN Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AGXT2 PE=1 SV=1
12	PDB:1sf2A	0.854	0.902	9.389E-34	425	0.242	0.256	1sf2A.pdb.gz	Crystal structures of unbound and aminooxyacetate-bound Escherichia coli gamma-aminobutyrate aminotransferase.
13	PDB:2byjA	0.772	0.854	5.927E-32	404	0.240	0.267	2byjA.pdb.gz	Determinants of Substrate Specificity in Omega-Aminotransferases.
14	PDB:5h7dA	0.816	0.746	2.000E-31	495	0.227	0.206	5h7dA.pdb.gz	Construction of novel repeat proteins with rigid and predictable structures using a shared helix method.
15	PDB:7jh3A	0.831	0.887	4.102E-31	420	0.247	0.264	7jh3A.pdb.gz
16	PDB:4a6tC	0.854	0.845	7.962E-31	455	0.242	0.240	4a6tC.pdb.gz	Crystal Structures of the Chromobacterium Violaceum Omega-Transaminase Reveal Major Structural Rearrangements Upon Binding of Coenzyme Plp.
17	PDB:3ntjB	0.753	0.856	5.026E-29	393	0.207	0.237	3ntjB.pdb.gz
18	PDB:4ppmA	0.823	0.799	2.001E-28	464	0.220	0.213	4ppmA.pdb.gz	Crystal structure of the catalytic domain of PigE: a transaminase involved in the biosynthesis of 2-methyl-3-n-amyl-pyrrole (MAP) from Serratia sp. FS14
19	PDB:4b98A	0.822	0.838	5.720E-28	441	0.220	0.224	4b98A.pdb.gz	Structural Studies with Pseudomonas and Chromobacterium [Omega]-Aminotransferases Provide Insights Into Their Differing Substrate Specificity.
20	PDB:4a6uA	0.756	0.869	1.635E-27	389	0.216	0.249	4a6uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7SY54	0.0	610	492	0.622	0.569	AT2L1_DANRE Ethanolamine-phosphate phospho-lyase OS=Danio rerio OX=7955 GN=etnppl PE=2 SV=1
2	Q8IUZ5	0.0	934	450	1.000	1.000	AT2L2_HUMAN 5-phosphohydroxy-L-lysine phospho-lyase OS=Homo sapiens OX=9606 GN=PHYKPL PE=1 SV=1
3	Q8R1K4	0.0	827	467	0.869	0.837	AT2L2_MOUSE 5-phosphohydroxy-L-lysine phospho-lyase OS=Mus musculus OX=10090 GN=Phykpl PE=1 SV=1
4	Q8TBG4	0.0	633	499	0.640	0.577	AT2L1_HUMAN Ethanolamine-phosphate phospho-lyase OS=Homo sapiens OX=9606 GN=ETNPPL PE=1 SV=1
5	Q9VU95	1.24e-163	472	494	0.500	0.455	AGT2L_DROME Alanine--glyoxylate aminotransferase 2-like OS=Drosophila melanogaster OX=7227 GN=CG8745 PE=2 SV=2
6	Q940M2	7.54e-105	321	476	0.387	0.366	AGT21_ARATH Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AGT2 PE=1 SV=1
7	Q94AL9	3.78e-100	309	477	0.380	0.358	AGT22_ARATH Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AGT3 PE=1 SV=2
8	Q9SR86	4.04e-99	307	481	0.382	0.358	AGT23_ARATH Alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g08860 PE=2 SV=1
9	Q64565	2.36e-79	256	512	0.324	0.285	AGT2_RAT Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Agxt2 PE=1 SV=2
10	Q3UEG6	2.77e-79	256	513	0.342	0.300	AGT2_MOUSE Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Agxt2 PE=1 SV=1
11	Q9BYV1	5.87e-79	256	514	0.327	0.286	AGT2_HUMAN Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AGXT2 PE=1 SV=1
12	P94427	1.24e-49	176	436	0.284	0.294	GABT_BACSU Probable 4-aminobutyrate aminotransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=gabT PE=3 SV=1
13	Q9I6M4	2.19e-44	162	426	0.258	0.272	DAVT_PSEAE 5-aminovalerate aminotransferase DavT OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=davT PE=1 SV=1
14	P38021	2.67e-44	161	401	0.269	0.302	OAT_BACSU Ornithine aminotransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=rocD PE=1 SV=2
15	Q9US34	1.04e-43	161	448	0.262	0.263	YFZ7_SCHPO Uncharacterized aminotransferase C1039.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1039.07c PE=3 SV=1
16	E0SIE8	9.88e-42	156	471	0.278	0.265	E0SIE8_DICD3 4-aminobutyrate aminotransferase OS=Dickeya dadantii (strain 3937) OX=198628 GN=acsF PE=3 SV=1
17	P07991	5.33e-41	153	424	0.267	0.283	OAT_YEAST Ornithine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAR2 PE=1 SV=2
18	Q88RB9	2.51e-40	151	425	0.269	0.285	DAVT_PSEPK 5-aminovalerate aminotransferase DavT OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=davT PE=1 SV=1
19	Q9I6J2	6.27e-40	150	456	0.251	0.248	SPUC_PSEAE Putrescine--pyruvate aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=spuC PE=1 SV=1
20	Q9FNK4	4.61e-39	149	475	0.267	0.253	OAT_ARATH Ornithine aminotransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DELTA-OAT PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	13	16.4	Aminotransferase class I and II
2	PF00202 Aminotran_3	1.9e-72	255.9	Aminotransferase class-III

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310978

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000455459	0.996	Hydroxylysine kinase
2	9606.ENSP00000377040	0.948	Alpha-aminoadipic semialdehyde synthase, mitochondrial
3	9606.ENSP00000387123	0.928	Alpha-aminoadipic semialdehyde dehydrogenase
4	9606.ENSP00000381949	0.647	Collagen alpha-1(XIII) chain
5	9606.ENSP00000251582	0.597	A disintegrin and metalloproteinase with thrombospondin motifs 2
6	9606.ENSP00000375069	0.591	Collagen type XXIII alpha 1 chain
7	9606.ENSP00000300605	0.573	Haloacid dehalogenase like hydrolase domain containing 2
8	9606.ENSP00000382083	0.556	Collagen alpha-1(XXV) chain
9	9606.ENSP00000205214	0.545	Acyl-CoA synthetase family member 4
10	9606.ENSP00000302620	0.528	Alanine-glyoxylate aminotransferase
11	9606.ENSP00000413937	0.518	Inositol polyphosphate 5-phosphatase K
12	9606.ENSP00000315870	0.508	Zinc finger protein 575
13	9606.ENSP00000354571	0.506	Ring finger protein 121

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008483	0.999	transaminase activity
GO:0042802	0.998	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0008152	0.936	metabolic process
GO:0071704	0.899	organic substance metabolic process
GO:0044237	0.767	cellular metabolic process
GO:0006807	0.728	nitrogen compound metabolic process
GO:1901564	0.607	organonitrogen compound metabolic process
GO:0044238	0.407	primary metabolic process
GO:0044281	0.351	small molecule metabolic process
GO:0050896	0.339	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0005759	0.740	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.6.1.-	0.999	Transaminases.

[back to server]