StarFunc result for job id Q8IV20

User Input

>input (430 residues)
MAEAVLIDLFGLKLNSQKNCHQTLLKTLNAVQYHHAAKAKFLCIMCCSNISYERDGEQDN
CEIETSNGLSALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVIVPRHRKTLMKAFID
QLFTDVYNFEFEDLQVTFRGGLFKQSIEINVITAQELRGIQNEIETFLRSLPALRGKLTI
ITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQENLRRLANAAGFNV
EKFYRIKTHHSNDIWIMGRKEPDSYDGITTNQRGVTIAALGADCIPIVFADPVKKACGVA
HAGWKGTLLGVAMATVNAMIAEYGCSLEDIVVVLGPSVGPCCFTLPRESAEAFHNLHPAC
VQLFDSPNPCIDIRKATRILLEQGGILPQNIQDQNQDLNLCTSCHPDKFFSHVRDGLNFG
TQIGFISIKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IV20	1.000	1.000	1.058E-93	430	1.000	1.000	Q8IV20.pdb.gz	LACC1_HUMAN Purine nucleoside phosphorylase LACC1 OS=Homo sapiens OX=9606 GN=LACC1 PE=1 SV=1
2	AFDB:Q8BZT9	0.934	0.934	5.204E-76	430	0.772	0.772	Q8BZT9.pdb.gz	LACC1_MOUSE Purine nucleoside phosphorylase LACC1 OS=Mus musculus OX=10090 GN=Lacc1 PE=1 SV=1
3	PDB:1t8hA	0.516	0.801	4.039E-23	272	0.181	0.287	1t8hA.pdb.gz	1.8 A CRYSTAL STRUCTURE OF AN UNCHARACTERIZED B. STEAROTHERMOPHILUS PROTEIN
4	AFDB:P84138	0.509	0.786	8.322E-23	274	0.179	0.281	P84138.pdb.gz	PURNU_GEOS3 Purine nucleoside phosphorylase YlmD OS=Geobacillus stearothermophilus (strain DSM 13240 / CIP 106956 / 10) OX=272567 GN=ylmD PE=1 SV=2
5	AFDB:Q1EIR0	0.513	0.822	9.829E-22	262	0.172	0.282	Q1EIR0.pdb.gz	PURNU_UNKP Adenosine deaminase RL5 OS=Unknown prokaryotic organism OX=2725 GN=rl5 PE=1 SV=1
6	AFDB:Q89ZI8	0.537	0.840	5.097E-21	270	0.156	0.248	Q89ZI8.pdb.gz	PURNU_BACTN Purine nucleoside phosphorylase BT_4389 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4389 PE=1 SV=1
7	PDB:7w1gC	0.517	0.892	8.502E-21	243	0.158	0.280	7w1gC.pdb.gz	Structural Basis for the Peptidoglycan-Editing Activity of YfiH.
8	AFDB:P33644	0.516	0.892	1.231E-20	243	0.160	0.284	P33644.pdb.gz	PURNU_ECOLI Purine nucleoside phosphorylase YfiH OS=Escherichia coli (strain K12) OX=83333 GN=yfiH PE=1 SV=1
9	AFDB:Q47QW5	0.514	0.892	4.758E-20	241	0.165	0.295	Q47QW5.pdb.gz	Q47QW5_THEFY Purine nucleoside phosphorylase OS=Thermobifida fusca (strain YX) OX=269800 GN=Tfu_1114 PE=3 SV=1
10	AFDB:P9WKD5	0.491	0.826	7.540E-19	250	0.147	0.252	P9WKD5.pdb.gz	PURNU_MYCTU Purine nucleoside phosphorylase Rv2149c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2149c PE=1 SV=1
11	AFDB:Q8VYN9	0.146	0.232	2.992E-3	242	0.049	0.087	Q8VYN9.pdb.gz	PHO32_ARATH Universal stress protein PHOS32 OS=Arabidopsis thaliana OX=3702 GN=PHOS32 PE=1 SV=1
12	PDB:2qjoB	0.189	0.231	9.528E-3	336	0.077	0.098	2qjoB.pdb.gz	Bifunctional NMN Adenylyltransferase/ADP-Ribose Pyrophosphatase: Structure and Function in Bacterial NAD Metabolism.
13	AFDB:Q94A51	0.190	0.111	9.696E-3	805	0.070	0.037	Q94A51.pdb.gz	PUB32_ARATH U-box domain-containing protein 32 OS=Arabidopsis thaliana OX=3702 GN=PUB32 PE=1 SV=1
14	PDB:6xp1B	0.157	0.214	2.588E-2	281	0.056	0.085	6xp1B.pdb.gz	In crystallo screening for proline analog inhibitors of the proline cycle enzyme PYCR1.
15	PDB:6a0fB	0.162	0.219	3.274E-2	305	0.040	0.056	6a0fB.pdb.gz	Structural Analyses on the Deamidation of N-Terminal Asn in the Human N-Degron Pathway.
16	PDB:6peyB	0.131	0.169	3.906E-2	290	0.051	0.076	6peyB.pdb.gz	Examination of Asp120Ala a Chemically Important Novel Mutation in the Enzyme Mthylenetetrahydrofolate Reductase
17	PDB:6agbJ	0.143	0.189	4.659E-2	293	0.063	0.092	6agbJ.pdb.gz	Structural insight into precursor tRNA processing by yeast ribonuclease P.
18	PDB:4fixA	0.160	0.114	5.240E-2	629	0.021	0.014	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
19	PDB:1jx7A	0.098	0.279	7.031E-2	117	0.033	0.120	1jx7A.pdb.gz
20	PDB:1fdrA	0.185	0.289	7.908E-2	244	0.030	0.053	1fdrA.pdb.gz	The three-dimensional structure of flavodoxin reductase from Escherichia coli at 1.7 A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BZT9	0.0	689	430	0.772	0.772	LACC1_MOUSE Purine nucleoside phosphorylase LACC1 OS=Mus musculus OX=10090 GN=Lacc1 PE=1 SV=1
2	Q8IV20	0.0	893	430	1.000	1.000	LACC1_HUMAN Purine nucleoside phosphorylase LACC1 OS=Homo sapiens OX=9606 GN=LACC1 PE=1 SV=1
3	P84138	3.90e-26	108	274	0.184	0.288	PURNU_GEOS3 Purine nucleoside phosphorylase YlmD OS=Geobacillus stearothermophilus (strain DSM 13240 / CIP 106956 / 10) OX=272567 GN=ylmD PE=1 SV=2
4	Q1EIR0	1.10e-18	87.4	262	0.126	0.206	PURNU_UNKP Adenosine deaminase RL5 OS=Unknown prokaryotic organism OX=2725 GN=rl5 PE=1 SV=1
5	Q47QW5	1.49e-18	86.7	241	0.167	0.299	Q47QW5_THEFY Purine nucleoside phosphorylase OS=Thermobifida fusca (strain YX) OX=269800 GN=Tfu_1114 PE=3 SV=1
6	Q89ZI8	1.16e-16	82.0	270	0.165	0.263	PURNU_BACTN Purine nucleoside phosphorylase BT_4389 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4389 PE=1 SV=1
7	P33644	2.38e-14	74.7	243	0.151	0.267	PURNU_ECOLI Purine nucleoside phosphorylase YfiH OS=Escherichia coli (strain K12) OX=83333 GN=yfiH PE=1 SV=1
8	P9WKD5	1.52e-08	57.4	250	0.140	0.240	PURNU_MYCTU Purine nucleoside phosphorylase Rv2149c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2149c PE=1 SV=1
9	Q0GUM3	1.6	33.5	417	0.042	0.043	IRB10_MOUSE Interferon-gamma-inducible GTPase 10 OS=Mus musculus OX=10090 GN=Gm12250 PE=1 SV=1
10	Q3UGF1	3.4	32.7	1341	0.056	0.018	WDR19_MOUSE WD repeat-containing protein 19 OS=Mus musculus OX=10090 GN=Wdr19 PE=1 SV=1
11	Q8NEZ3	3.7	32.7	1342	0.051	0.016	WDR19_HUMAN WD repeat-containing protein 19 OS=Homo sapiens OX=9606 GN=WDR19 PE=1 SV=2
12	Q6ZTR5	4.0	32.3	3187	0.060	0.008	CFA47_HUMAN Cilia- and flagella-associated protein 47 OS=Homo sapiens OX=9606 GN=CFAP47 PE=1 SV=5
13	Q811B3	6.3	32.0	1600	0.063	0.017	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02578 Cu-oxidase_4	3.8e-61	218.1	Multi-copper polyphenol oxidoreductase laccase
2	PF14522 Cytochrome_C7	5.1e+02	11.9	Cytochrome c7 and related cytochrome c

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000391747

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000407763	0.864	Coiled-coil domain containing 122
2	9606.ENSP00000349877	0.705	Manganese-transporting ATPase 13A1
3	9606.ENSP00000378402	0.680	Paired amphipathic helix protein Sin3a
4	9606.ENSP00000292314	0.663	Coiled-coil domain containing 12
5	9606.ENSP00000337946	0.638	Parkin coregulated gene protein
6	9606.ENSP00000363157	0.624	Tumor necrosis factor ligand superfamily member 15
7	9606.ENSP00000220751	0.612	Receptor-interacting serine/threonine-protein kinase 2
8	9606.ENSP00000354774	0.609	SPRY domain containing 7
9	9606.ENSP00000300589	0.603	Nucleotide-binding oligomerization domain-containing protein 2
10	9606.ENSP00000465500	0.592	Tumor necrosis factor receptor superfamily member 11A
11	9606.ENSP00000331288	0.578	Stimulator of interferon genes protein
12	9606.ENSP00000333551	0.552	Pyridoxal phosphate homeostasis protein
13	9606.ENSP00000228740	0.539	Leukotriene A-4 hydrolase
14	9606.ENSP00000248444	0.537	Villin-1
15	9606.ENSP00000298910	0.529	Leucine-rich repeat serine/threonine-protein kinase 2
16	9606.ENSP00000349238	0.522	Coiled-coil domain-containing protein 88B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0047975	1.000	guanosine phosphorylase activity
GO:0017061	1.000	S-methyl-5-thioadenosine phosphorylase activity
GO:0004000	1.000	adenosine deaminase activity
GO:0043167	0.322	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0002682	0.985	regulation of immune system process
GO:0050896	0.980	response to stimulus
GO:0050776	0.971	regulation of immune response
GO:0002831	0.936	regulation of response to biotic stimulus
GO:0051716	0.929	cellular response to stimulus
GO:0019222	0.909	regulation of metabolic process
GO:0002376	0.881	immune system process
GO:0048584	0.860	positive regulation of response to stimulus
GO:0002684	0.851	positive regulation of immune system process
GO:0007165	0.850	signal transduction
GO:0031347	0.848	regulation of defense response
GO:0032101	0.708	regulation of response to external stimulus
GO:0045088	0.681	regulation of innate immune response
GO:0060255	0.675	regulation of macromolecule metabolic process
GO:0010468	0.672	regulation of gene expression
GO:0050778	0.669	positive regulation of immune response
GO:0010604	0.621	positive regulation of macromolecule metabolic process
GO:0032103	0.500	positive regulation of response to external stimulus
GO:0002833	0.484	positive regulation of response to biotic stimulus
GO:0031349	0.469	positive regulation of defense response
GO:0045089	0.461	positive regulation of innate immune response
GO:0002253	0.422	activation of immune response
GO:0002218	0.403	activation of innate immune response
GO:0001817	0.400	regulation of cytokine production
GO:0051171	0.387	regulation of nitrogen compound metabolic process
GO:0080090	0.385	regulation of primary metabolic process
GO:0031323	0.384	regulation of cellular metabolic process
GO:0002764	0.348	immune response-regulating signaling pathway
GO:0001819	0.346	positive regulation of cytokine production
GO:0002757	0.340	immune response-activating signaling pathway
GO:0002221	0.315	pattern recognition receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0005783	0.933	endoplasmic reticulum
GO:0005634	0.792	nucleus
GO:0042579	0.751	microbody
GO:0005777	0.740	peroxisome
GO:0016020	0.585	membrane
GO:0005829	0.530	cytosol
GO:0070013	0.421	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13233	1.000	guanosine + phosphate = alpha-D-ribose 1-phosphate + guanine
EC:2.4.2.15	1.000	guanosine phosphorylase.
RHEA:24408	1.000	adenosine + H(+) + H2O = inosine + NH4(+)
RHEA:11852	1.000	phosphate + S-methyl-5'-thioadenosine = adenine + S-methyl-5-thio-alpha-D-ribose 1-phosphate
EC:3.5.4.4	1.000	adenosine deaminase.
EC:2.4.2.28	1.000	S-methyl-5'-thioadenosine phosphorylase.

[back to server]