StarFunc result for job id Q8IV33

User Input

>input (1275 residues)
MDWDDEYSHNSFDLHCLLNSFPGDLEFEQIFSDIDEKIEQNAASIKHCIKEIQSEINKQC
PGVQLQTTTDCFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD
LSCHSSVSFPSTLSGTSFHFLSRTSLHSVEDNSSMDVKSMWDDIRLHLRRFLVSKLQSHN
EINNSQQKILLKKQCLQQLLFLYPESEVIIKYQNIQNKLLANLLWNCFPSYNRDSNLDVI
AHGYQSTMLKLYSVIKEDFNTLCEILAPSSMVKFIKETYLDTVTEEMAKFLENFCELQFR
ENAVRVVKTSKSSSKHRGAVHALVTTECPQKGRNFSLPLDKVEFLSQLIKSFMKLEKGVQ
ELFDEILLSLKITRDTSGILEKSDREVVMEKPRANETNIPSEQSLPGKEATLLDFGWRSA
FKEVSLPMAHCVVTAIEGFSTKILQQEQNERSSAVSYAMNLVNVQQVWQDSHMFPEEEQP
KKIGKFCSDIMEKLDTMLPLALACRDDSFQEIRANLVEACCKVATAVLQRLQERAKEVPS
KAPLKNLHTYLSTAVYVFQHFKRYDNLMKEMTKKPIFLVLVQRYQEFINTLQFQVTNYCV
RVCATSILQDAESHHWDDYKAFYEGERCSFSIQMWHYFCWSLHYDLWTILPPKLAQEILV
EVLEKSLSLLASRYARAHPSRKRTPQLRLDVTTILICTENMLWSVCTSVQKLLNPHQHTD
DKIFKIHTHCNNLFTTLVILTSPLTELYKTFQHGLDESASDSLKSFFKQPLYWVSCISHF
YPSLLRTPSAGGLKAEGQLKLLLSQPRCNWNLLLETLLHHDGLLLRILLKSSKQVSDTEN
NLNQGPSLMEAIFKILYHCSFSPQTFANVFVSYMEEEQLWDFLYNIPVSTCVEYELEVIR
CLRLALTDAIKDTVQQIVSVMSSRRNCETNLNKHIVPDCLLESMPKEWNYSPKETNRKES
CKSFTRLTAQAVSIVISKLPTVIACLPPPVKYFFFLSERKMSKKFVELKKAGLLVWNLIV
IICRIFEDGNTVELLTGASLDRWSKEKLGLICMCLKSIMGDQTSIHNQMIQKVIQSIEQQ
KPNWIERQLLKARKLSTECAFMTIEKSTALQEGDVALELTEQKINTMVLDLCHKPGGREY
LRQIYHIMQLNEEYLKEQLFSMNSSEEKPLPIRPLKTTLRSIEDQPSAFNPFHVYKAFSE
NMLDQSAITKWNWNWAKLLPNYLRLDKMTFSVLLKNRWEMKKDETLEEEEKAILEHLKQI
CTPQNSSASDNIEEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IV33	1.000	1.000	0.000	1275	1.000	1.000	Q8IV33.pdb.gz	K0825_HUMAN Uncharacterized protein KIAA0825 OS=Homo sapiens OX=9606 GN=KIAA0825 PE=1 SV=3
2	AFDB:D6XJQ7	0.219	0.258	3.131E-6	1015	0.069	0.087	D6XJQ7.pdb.gz	D6XJQ7_TRYB2 Conserved oligomeric Golgi complex subunit 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.10 PE=3 SV=1
3	AFDB:Q57WT5	0.102	0.100	8.323E-6	1312	0.109	0.106	Q57WT5.pdb.gz	Q57WT5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.300 PE=4 SV=1
4	PDB:7mp5A	0.114	0.101	8.181E-5	1629	0.083	0.065	7mp5A.pdb.gz
5	AFDB:O00471	0.206	0.340	8.567E-5	708	0.067	0.121	O00471.pdb.gz	EXOC5_HUMAN Exocyst complex component 5 OS=Homo sapiens OX=9606 GN=EXOC5 PE=1 SV=1
6	AFDB:B0BLY0	0.211	0.341	8.895E-5	708	0.067	0.120	B0BLY0.pdb.gz	B0BLY0_DANRE Exocyst complex component 5 OS=Danio rerio OX=7955 GN=exoc5 PE=1 SV=1
7	PDB:7r04A	0.125	0.079	2.938E-4	2326	0.096	0.053	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
8	PDB:7useB	0.078	0.085	2.938E-4	1099	0.106	0.123	7useB.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
9	PDB:7r04B	0.125	0.077	5.782E-4	2229	0.100	0.057	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
10	PDB:7r03B	0.125	0.083	1.016E-3	2246	0.096	0.055	7r03B.pdb.gz
11	AFDB:Q06096	0.239	0.319	1.147E-3	861	0.065	0.096	Q06096.pdb.gz	COG4_YEAST Conserved oligomeric Golgi complex subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COG4 PE=1 SV=1
12	PDB:3w3uA	0.112	0.125	2.000E-3	1030	0.095	0.117	3w3uA.pdb.gz
13	PDB:7unkA	0.086	0.095	2.000E-3	1047	0.114	0.138	7unkA.pdb.gz
14	PDB:7dkhI	0.078	0.096	2.325E-3	914	0.099	0.138	7dkhI.pdb.gz
15	AFDB:Q38BW6	0.080	0.092	2.434E-3	1068	0.119	0.142	Q38BW6.pdb.gz	Q38BW6_TRYB2 Conserved oligomeric Golgi complex subunit 6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4860 PE=3 SV=1
16	PDB:6vaeA	0.121	0.126	2.913E-3	1198	0.105	0.112	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
17	PDB:7qpgW	0.184	0.285	3.516E-3	779	0.075	0.122	7qpgW.pdb.gz
18	AFDB:P49021	0.089	0.084	8.742E-3	1398	0.100	0.091	P49021.pdb.gz	TIM_DROME Protein timeless OS=Drosophila melanogaster OX=7227 GN=tim PE=1 SV=3
19	AFDB:Q6IDD9	0.085	0.082	1.055E-2	1360	0.083	0.078	Q6IDD9.pdb.gz	SARM1_DROME NAD(+) hydrolase sarm1 OS=Drosophila melanogaster OX=7227 GN=Sarm PE=1 SV=1
20	AFDB:P39531	0.158	0.225	4.573E-2	840	0.070	0.106	P39531.pdb.gz	RCY1_YEAST Recyclin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RCY1 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IV33	0.0	2635	1275	1.000	1.000	K0825_HUMAN Uncharacterized protein KIAA0825 OS=Homo sapiens OX=9606 GN=KIAA0825 PE=1 SV=3
2	P90786	0.13	38.9	824	0.020	0.032	P90786_CAEEL Piwi-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=prg-1 PE=1 SV=1
3	Q8BW72	0.63	37.0	1064	0.019	0.023	KDM4A_MOUSE Lysine-specific demethylase 4A OS=Mus musculus OX=10090 GN=Kdm4a PE=1 SV=3
4	Q6FVH4	3.1	34.3	505	0.020	0.050	Q6FVH4_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=YPS10 PE=3 SV=1
5	Q9VTG7	3.1	34.3	479	0.015	0.040	B3G2P_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase P OS=Drosophila melanogaster OX=7227 GN=GlcAT-P PE=2 SV=1
6	A0A0G2K5I7	3.7	34.3	1062	0.018	0.022	A0A0G2K5I7_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4a PE=3 SV=1
7	D4A2N4	3.9	34.3	971	0.018	0.024	D4A2N4_RAT Lysine demethylase 4A OS=Rattus norvegicus OX=10116 GN=Kdm4a PE=4 SV=1
8	Q8WZ42	4.1	34.3	34350	0.024	0.001	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
9	Q8WN95	4.9	33.9	2664	0.022	0.011	ITPR3_BOVIN Inositol 1,4,5-trisphosphate receptor type 3 OS=Bos taurus OX=9913 GN=ITPR3 PE=2 SV=1
10	O96559	5.7	33.5	364	0.014	0.049	APY_CIMLE Apyrase OS=Cimex lectularius OX=79782 GN=APY PE=1 SV=1
11	A0A8I5ZU83	6.2	33.9	26931	0.021	0.001	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
12	P34560	7.0	32.7	226	0.030	0.168	RMD1_CAEEL Regulator of microtubule dynamics protein 1 OS=Caenorhabditis elegans OX=6239 GN=rmd-1 PE=1 SV=2
13	A2ASS6	7.3	33.5	35213	0.021	0.001	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
14	A0A8I5ZUN3	7.4	33.5	35375	0.021	0.001	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14906 DUF4495	9.3e-136	463.6	Domain of unknown function (DUF4495)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000029228

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000029223	0.508	Family with sequence similarity 172, member A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.964	regulation of cellular process
GO:0032501	0.735	multicellular organismal process
GO:0071840	0.686	cellular component organization or biogenesis
GO:0016043	0.650	cellular component organization
GO:0048856	0.578	anatomical structure development
GO:0008152	0.478	metabolic process
GO:0048468	0.435	cell development
GO:0048523	0.422	negative regulation of cellular process
GO:0060255	0.415	regulation of macromolecule metabolic process
GO:0044237	0.408	cellular metabolic process
GO:0006996	0.406	organelle organization
GO:0022607	0.405	cellular component assembly
GO:0071704	0.394	organic substance metabolic process
GO:0007275	0.394	multicellular organism development
GO:0010468	0.379	regulation of gene expression
GO:0044238	0.377	primary metabolic process
GO:0048731	0.374	system development
GO:0006807	0.363	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043226	0.989	organelle
GO:0043229	0.974	intracellular organelle
GO:0043227	0.914	membrane-bounded organelle
GO:0043231	0.876	intracellular membrane-bounded organelle
GO:0005634	0.830	nucleus
GO:0005829	0.508	cytosol
GO:0071944	0.446	cell periphery
GO:0016020	0.411	membrane
GO:0043232	0.408	intracellular non-membrane-bounded organelle
GO:0005886	0.354	plasma membrane
GO:0012505	0.313	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]