StarFunc result for job id Q8IV76

User Input

>input (773 residues)
MKMRGEKRRDKVNPKSSQRKLNWIPSFPTYDYFNQVTLQLLDGFMITLSTDGVIICVAEN
ISSLLGHLPAEIVGKKLLSLLPDEEKDEVYQKIILKFPLLNSETHIEFCCHLKRGNVEHG
DSSAYENVKFIVNVRDICNEFPVVFSGLFSSHLCADFAACVPQEDRLYLVGNVCILRTQL
LQQLYTSKAVSDEAVLTQDSDEEPFVGELSSSQGQRGHTSMKAVYVEPAAAAAAAAISDD
QIDIAEVEQYGPQENVHMFVDSDSTYCSSTVFLDTMPESPALSLQDFRGEPEVNPLYRAD
PVDLEFSVDQVDSVDQEGPMDQQDPENPVAPLDQAGLMDPVDPEDSVDLGAAGASAQPLQ
PSSPVAYDIISQELELMKKLKEQLEERTWLLHDAIQNQQNALELMMDHLQKQPNTLRHVV
IPDLQSSEAVPKKQQKQHAGQVKRPLPHPKDVKCFCGLSLSNSLKNTGELQEPCVAFNQQ
QLVQQEQHLKEQQRQLREQLQQLREQRKVQKQKKMQEKKKLQEQKMQEKKKLQEQRRQKK
KKLQERKKWQGQMLQKEPEEEQQKQQLQEQPLKHNVIVGNERVQICLQNPRDVSVPLCNH
PVRFLQAQPIVPVQRAAEQQPSGFYQDENCGQQEDESQSFYPEAYQGPPVNQLPLIDTSN
SEAISSSSIPQFPITSDSTISTLETPQDYIRLWQELSDSLGPVVQVNTWSCDEQGTLHGQ
PTYHQVQVSEVGVEGPPDPQAFQGPAAYQPDQMRSAEQTRLMPAEQRDSNKPC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IV76	0.999	0.999	0.000	773	1.000	1.000	Q8IV76.pdb.gz	PASD1_HUMAN Circadian clock protein PASD1 OS=Homo sapiens OX=9606 GN=PASD1 PE=1 SV=1
2	AFDB:Q8JIG3	0.167	0.154	2.837E-15	845	0.188	0.172	Q8JIG3.pdb.gz	Q8JIG3_DANRE BHLH-PAS transcription factor OS=Danio rerio OX=7955 GN=zfCLOCK2 PE=2 SV=1
3	AFDB:Q91YB0	0.159	0.143	1.229E-14	865	0.185	0.165	Q91YB0.pdb.gz	CLOCK_NANGA Circadian locomoter output cycles protein kaput OS=Nannospalax galili OX=1026970 GN=Clock PE=1 SV=1
4	AFDB:Q9W6J4	0.165	0.145	8.325E-14	893	0.190	0.165	Q9W6J4.pdb.gz
5	AFDB:Q8QGQ6	0.160	0.142	3.385E-13	875	0.181	0.160	Q8QGQ6.pdb.gz	CLOCK_CHICK Circadian locomoter output cycles protein kaput OS=Gallus gallus OX=9031 GN=CLOCK PE=1 SV=2
6	AFDB:O15945	0.130	0.155	7.905E-7	642	0.097	0.117	O15945.pdb.gz	ARNT_DROME Aryl hydrocarbon receptor nuclear translocator homolog OS=Drosophila melanogaster OX=7227 GN=tgo PE=1 SV=3
7	PDB:6umzA	0.113	0.528	1.353E-4	127	0.036	0.220	6umzA.pdb.gz	Structural and spectroscopic characterization of photoactive yellow protein and photoswitchable fluorescent protein constructs containing heavy atoms.
8	PDB:7rzwB	0.116	0.104	1.614E-2	864	0.019	0.017	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
9	AFDB:Q09388	0.056	0.067	1.758E-2	627	0.079	0.097	Q09388.pdb.gz	ACM2_CAEEL Muscarinic acetylcholine receptor gar-2 OS=Caenorhabditis elegans OX=6239 GN=gar-2 PE=2 SV=3
10	AFDB:P07663	0.119	0.078	2.577E-2	1224	0.127	0.080	P07663.pdb.gz	PER_DROME Period circadian protein OS=Drosophila melanogaster OX=7227 GN=per PE=1 SV=2
11	AFDB:Q9H987	0.067	0.058	4.875E-2	977	0.114	0.090	Q9H987.pdb.gz	SYP2L_HUMAN Synaptopodin 2-like protein OS=Homo sapiens OX=9606 GN=SYNPO2L PE=1 SV=3
12	AFDB:M9PET2	0.070	0.106	1.352E-1	451	0.113	0.193	M9PET2.pdb.gz	M9PET2_DROME Target of wingless, isoform E OS=Drosophila melanogaster OX=7227 GN=tow PE=4 SV=1
13	PDB:7pzyE	0.044	0.105	3.443E-1	223	0.019	0.067	7pzyE.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
14	PDB:5datS3	0.043	0.103	6.514E-1	223	0.023	0.081	5datS3.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
15	PDB:4d2iA	0.042	0.063	7.400E-1	464	0.012	0.019	4d2iA.pdb.gz	Structure of the Hexameric Hera ATPase Reveals a Mechanism of Translocation-Coupled DNA-End Processing in Archaea
16	PDB:7bwnJ	0.045	0.097	9.550E-1	280	0.013	0.036	7bwnJ.pdb.gz	Cellular Synthesis and X-ray Crystal Structure of a Designed Protein Heterocatenane.
17	PDB:8dhbJ	0.084	0.155	1.156	361	0.018	0.039	8dhbJ.pdb.gz	Structural basis for FLCN RagC GAP activation in MiT-TFE substrate-selective mTORC1 regulation.
18	PDB:2fs2B	0.051	0.129	1.313	138	0.025	0.138	2fs2B.pdb.gz
19	PDB:5loeA	0.072	0.159	1.807	258	0.019	0.058	5loeA.pdb.gz	Structure of the Branched-chain Amino Acid and GTP-sensing Global Regulator, CodY, from Bacillus subtilis.
20	PDB:3ms6A	0.073	0.354	2.187	91	0.017	0.143	3ms6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IV76	0.0	1585	773	1.000	1.000	PASD1_HUMAN Circadian clock protein PASD1 OS=Homo sapiens OX=9606 GN=PASD1 PE=1 SV=1
2	Q8JIG3	2.67e-27	120	845	0.094	0.086	Q8JIG3_DANRE BHLH-PAS transcription factor OS=Danio rerio OX=7955 GN=zfCLOCK2 PE=2 SV=1
3	Q5RIV1	2.28e-24	111	892	0.088	0.076	Q5RIV1_DANRE Circadian locomoter output cycles protein kaput OS=Danio rerio OX=7955 GN=clock PE=1 SV=1
4	A2I2P5	4.66e-24	110	824	0.089	0.084	A2I2P5_HUMAN Neuronal PAS domain protein 2 OS=Homo sapiens OX=9606 GN=NPAS2 PE=4 SV=1
5	Q99743	4.66e-24	110	824	0.089	0.084	NPAS2_HUMAN Neuronal PAS domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NPAS2 PE=1 SV=3
6	Q91YB0	1.63e-23	108	865	0.085	0.076	CLOCK_NANGA Circadian locomoter output cycles protein kaput OS=Nannospalax galili OX=1026970 GN=Clock PE=1 SV=1
7	P97460	1.65e-23	108	816	0.087	0.082	NPAS2_MOUSE Neuronal PAS domain-containing protein 2 OS=Mus musculus OX=10090 GN=Npas2 PE=1 SV=1
8	O15516	2.61e-23	108	846	0.085	0.078	CLOCK_HUMAN Circadian locomoter output cycles protein kaput OS=Homo sapiens OX=9606 GN=CLOCK PE=1 SV=1
9	O08785	4.52e-23	107	855	0.083	0.075	CLOCK_MOUSE Circadian locomoter output cycles protein kaput OS=Mus musculus OX=10090 GN=Clock PE=1 SV=1
10	B3DH92	7.57e-23	106	820	0.087	0.082	B3DH92_DANRE Clock circadian regulator b OS=Danio rerio OX=7955 GN=clock3 PE=2 SV=1
11	Q9WVS9	1.05e-22	106	862	0.083	0.074	CLOCK_RAT Circadian locomoter output cycles protein kaput OS=Rattus norvegicus OX=10116 GN=Clock PE=2 SV=1
12	Q5ZQU2	3.34e-22	104	815	0.080	0.076	NPAS2_CHICK Neuronal PAS domain-containing protein 2 OS=Gallus gallus OX=9031 GN=NPAS2 PE=1 SV=1
13	Q8QGQ6	6.62e-21	100	875	0.079	0.070	CLOCK_CHICK Circadian locomoter output cycles protein kaput OS=Gallus gallus OX=9031 GN=CLOCK PE=1 SV=2
14	O61735	2.10e-13	76.6	1027	0.050	0.038	CLOCK_DROME Circadian locomoter output cycles protein kaput OS=Drosophila melanogaster OX=7227 GN=Clk PE=1 SV=3
15	Q8IDX6	1.21e-06	55.1	3130	0.054	0.013	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
16	Q8N9W4	3.87e-04	46.6	909	0.044	0.037	GG6L2_HUMAN Golgin subfamily A member 6-like protein 2 OS=Homo sapiens OX=9606 GN=GOLGA6L2 PE=1 SV=3
17	C6KSX6	0.001	44.7	1422	0.041	0.023	C6KSX6_PLAF7 Rhoptry protein ROP14 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0613300 PE=3 SV=1
18	O44118	0.001	45.1	716	0.031	0.034	O44118_DROME Juvenile hormone resistance protein OS=Drosophila melanogaster OX=7227 GN=Met PE=2 SV=1
19	Q8I4Z1	0.001	44.7	1846	0.039	0.016	Q8I4Z1_PLAF7 Double C2-like domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1243900 PE=4 SV=1
20	Q9VYW2	0.001	45.1	716	0.031	0.034	Q9VYW2_DROME FI10506p OS=Drosophila melanogaster OX=7227 GN=Met PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00989 PAS	0.86	21.0	PAS fold
2	PF08448 PAS_4	59	15.3	PAS fold

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359382

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287538	0.924	Zinc finger protein ZIC 3
2	9606.ENSP00000244096	0.862	Melanoma-associated antigen 10
3	9606.ENSP00000285879	0.859	Melanoma-associated antigen C1
4	9606.ENSP00000354660	0.848	Melanoma-associated antigen C2
5	9606.ENSP00000353379	0.785	Melanoma-associated antigen 4
6	9606.ENSP00000355421	0.712	G antigen 2A
7	9606.ENSP00000329374	0.677	Thyroxine-binding globulin
8	9606.ENSP00000473093	0.668	Melanoma-associated antigen 3
9	9606.ENSP00000359940	0.665	Immunoglobulin superfamily member 1
10	9606.ENSP00000349085	0.661	Melanoma-associated antigen 1
11	9606.ENSP00000359310	0.629	Putative chondrosarcoma-associated gene 1 protein
12	9606.ENSP00000263321	0.619	Tyrosinase
13	9606.ENSP00000364555	0.602	Actin-like protein 8
14	9606.ENSP00000276241	0.582	Cancer/testis antigen 55
15	9606.ENSP00000323191	0.578	Sarcoma antigen 1
16	9606.ENSP00000484645	0.569	Nuclear RNA export factor 2B
17	9606.ENSP00000445675	0.568	Melanoma antigen preferentially expressed in tumors
18	9606.ENSP00000485586	0.565	Nuclear RNA export factor 2
19	9606.ENSP00000359361	0.556	Probable ATP-dependent RNA helicase DDX43
20	9606.ENSP00000377836	0.546	Glypican-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140416	1.000	transcription regulator inhibitor activity
GO:0140297	1.000	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0006355	0.991	regulation of DNA-templated transcription
GO:0048523	0.980	negative regulation of cellular process
GO:0031324	0.958	negative regulation of cellular metabolic process
GO:0045892	0.948	negative regulation of DNA-templated transcription
GO:0042752	0.900	regulation of circadian rhythm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005667	0.995	transcription regulator complex
GO:0140513	0.995	nuclear protein-containing complex
GO:0016604	0.993	nuclear body
GO:0017053	0.986	transcription repressor complex
GO:0016607	0.983	nuclear speck
GO:0005737	0.923	cytoplasm
GO:1990512	0.736	Cry-Per complex
GO:0005829	0.503	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]