StarFunc result for job id Q8IVE3

User Input

>input (1493 residues)
MAELSEPEGPVDWKERCVALESQLMKFRVQASKIRELLAEKMQQLERQVIDAERQAEKAF
QQVQVMEDKLKAANIQTSESETRLYNKCQDLESLIQEKDDVIQNLELQLEEQKQIRIQEA
KIIEEKAAKIKEWVTVKLNELELENQNLRLINQNQTEEIRTMQSKLQEVQGKKSSTVSTL
KLSEGQRLSSLTFGCFLSRARSPPQVVKSEEMSKISSKEPEFTEGKDMEEMEIPEKSVDN
QVLENNRGQRTLHQTPCGSEQNRKTRTSFATDGGISQNSGAPVSDWSSDEEDGSKGRSKS
RCTSTLSSHTSEEGVQCSRMGSEMYLTASDDSSSIFEEETFGIKRPEHKKLYSWQQEAQW
KALNSPLGKGNSELSKKEQDSSSDELNKKFQSQRLDYSSSSSEANTPSPILTPALMPKHP
NSLSGKGTQLVPSSHLPPPKLRIPNVFSISVALAKRHLSQPQLSSDRMFGTNRNAISMIR
PLRPQETDLDLVDGDSTEVLENMDTSCDDGLFSYDSLDSPNSDDQEHCDSAKKVAYSKPP
TPPLHRFPSWESRIYAVAKSGIRMSEAFNMESVNKNSAATLSYTTSGLYTSLIYKNMTTP
VYTTLKGKATQISSSPFLDDSSGSEEEDSSRSSSRTSESDSRSRSGPGSPRAMKRGVSLS
SVASESDYAIPPDAYSTDTEYSQPEQKLPKTCSSSSDNGKNEPLEKSGYLLKMSGKVKSW
KRRWFVLKGGELLYYKSPSDVIRKPQGHIELSASCSILRGDNKQTVQLTTEKHTYYLTAD
SPNILEEWIKVLQNVLRVQAANPLSLQPEGKPTMKGLLTKVKHGYSKRVWCTLIGKTLYY
FRSQEDKFPLGQIKLWEAKVEEVDRSCDSDEDYEASGRSLLSTHYTIVIHPKDQGPTYLL
IGSKHEKDTWLYHLTVAAGSNNVNVGSEFEQLVCKLLNIDGEPSSQIWRHPTLCHSKEGI
ISPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHISLAQSALQICLTHPELQNEI
CCQLIKQTRRRQPQNQPGPLQGWQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKY
AIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFDAS
TTVEEFLNTLNQDTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIKICDIISKWEQASKEQ
QPGKCEGTRTVRLTYKNRLYFSVQARGETDREKLLLMYQTNDQIINGLFPLNKDLALEMA
ALLSQVEIGDFERPFSTPAGHVTNQCKVNQTLKQVIEKFYPKRYRDGCSEEQLRQLCQRL
STRWMALRGHSAADCVRIYLTVARKWPFFGAKLFLAKPITPSSLGSTFLWLAVHEDGLSL
LEYNSMRLIVSYVYKSLMTFGGYQDDFMVVINNTHSKDKPTEKLLFAMAKPKILEITLLI
ASYINNFHQQKAAFHHLSAPALLSAQTRGPQARMMGSQPLLSSSRPTKGPTLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q00IB7	0.381	0.397	0.000	1433	0.519	0.541	Q00IB7.pdb.gz	PKHH1_DANRE Pleckstrin homology domain-containing family H member 1 OS=Danio rerio OX=7955 GN=plekhh1 PE=2 SV=1
2	AFDB:Q8C115	0.550	0.551	0.000	1491	0.858	0.859	Q8C115.pdb.gz	PKHH2_MOUSE Pleckstrin homology domain-containing family H member 2 OS=Mus musculus OX=10090 GN=Plekhh2 PE=1 SV=3
3	AFDB:Q8IVE3	1.000	1.000	0.000	1493	1.000	1.000	Q8IVE3.pdb.gz	PKHH2_HUMAN Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens OX=9606 GN=PLEKHH2 PE=1 SV=2
4	AFDB:Q8WZ64	0.086	0.078	2.322E-12	1704	0.128	0.112	Q8WZ64.pdb.gz	ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARAP2 PE=1 SV=3
5	PDB:4rm8A	0.170	0.597	8.934E-12	368	0.035	0.141	4rm8A.pdb.gz
6	PDB:3ljuX	0.070	0.240	1.994E-10	373	0.027	0.110	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
7	AFDB:M9PC26	0.074	0.058	2.146E-7	2021	0.093	0.069	M9PC26.pdb.gz	M9PC26_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=CG10020 PE=1 SV=1
8	AFDB:Q9VDE9	0.123	0.135	3.786E-6	1330	0.127	0.142	Q9VDE9.pdb.gz	Q9VDE9_DROME FI04035p OS=Drosophila melanogaster OX=7227 GN=RhoGAP93B PE=2 SV=2
9	AFDB:Q5T5U3	0.060	0.046	1.875E-5	1958	0.085	0.065	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
10	PDB:6hhgA	0.057	0.207	2.951E-5	386	0.042	0.163	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
11	PDB:6u3eA	0.060	0.213	3.093E-5	397	0.024	0.091	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
12	PDB:6bbpA	0.060	0.162	3.562E-5	520	0.027	0.077	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
13	PDB:7c3mA	0.140	0.326	5.977E-5	577	0.029	0.076	7c3mA.pdb.gz
14	AFDB:A0A0R4IEP9	0.053	0.058	7.002E-5	1332	0.091	0.102	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
15	AFDB:Q9P227	0.065	0.065	7.002E-5	1491	0.090	0.090	Q9P227.pdb.gz	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
16	AFDB:Q9VGI1	0.059	0.064	9.286E-5	1354	0.085	0.094	Q9VGI1.pdb.gz	Q9VGI1_DROME FI23955p1 OS=Drosophila melanogaster OX=7227 GN=prd1 PE=2 SV=1
17	PDB:6r9tA	0.110	0.078	1.461E-4	2185	0.028	0.019	6r9tA.pdb.gz
18	PDB:6s9wA	0.055	0.187	3.252E-4	411	0.043	0.156	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
19	PDB:4mk0A	0.062	0.140	3.925E-4	631	0.014	0.033	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:6xtbE	0.067	0.341	4.313E-4	235	0.017	0.111	6xtbE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q00IB7	0.0	1260	1433	0.461	0.480	PKHH1_DANRE Pleckstrin homology domain-containing family H member 1 OS=Danio rerio OX=7955 GN=plekhh1 PE=2 SV=1
2	Q8C115	0.0	2561	1491	0.859	0.860	PKHH2_MOUSE Pleckstrin homology domain-containing family H member 2 OS=Mus musculus OX=10090 GN=Plekhh2 PE=1 SV=3
3	Q8IVE3	0.0	3100	1493	1.000	1.000	PKHH2_HUMAN Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens OX=9606 GN=PLEKHH2 PE=1 SV=2
4	G5ED24	7.23e-103	357	1099	0.163	0.222	G5ED24_CAEEL MAX-1A OS=Caenorhabditis elegans OX=6239 GN=max-1 PE=2 SV=1
5	I3ITL5	6.67e-24	112	2041	0.082	0.060	I3ITL5_DANRE Myosin X,-like 1 OS=Danio rerio OX=7955 GN=myo10l1 PE=3 SV=1
6	P79114	1.21e-20	102	2052	0.080	0.058	MYO10_BOVIN Unconventional myosin-X OS=Bos taurus OX=9913 GN=MYO10 PE=1 SV=1
7	F8VQB6	1.89e-20	101	2062	0.078	0.056	MYO10_MOUSE Unconventional myosin-X OS=Mus musculus OX=10090 GN=Myo10 PE=1 SV=1
8	E9PEW5	8.09e-20	99.0	1397	0.079	0.084	E9PEW5_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1
9	A0A0A0MQX1	2.64e-19	97.8	2069	0.079	0.057	A0A0A0MQX1_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1
10	Q9HD67	2.91e-19	97.4	2058	0.079	0.057	MYO10_HUMAN Unconventional myosin-X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=3
11	Q9DGG9	3.45e-15	84.3	2179	0.047	0.032	Q9DGG9_DANRE Myosin VIIA OS=Danio rerio OX=7955 GN=myo7A PE=2 SV=1
12	Q9V3Z6	1.09e-14	82.4	2167	0.048	0.033	MYO7A_DROME Myosin-VIIa OS=Drosophila melanogaster OX=7227 GN=ck PE=1 SV=1
13	Q13402	5.78e-14	80.1	2215	0.047	0.032	MYO7A_HUMAN Unconventional myosin-VIIa OS=Homo sapiens OX=9606 GN=MYO7A PE=1 SV=2
14	A0A8I5ZWB0	1.14e-13	79.3	2238	0.046	0.030	A0A8I5ZWB0_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
15	Q8CJE3	1.23e-13	79.0	2177	0.047	0.032	Q8CJE3_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=2 SV=1
16	A0A8J8XYU9	1.30e-13	79.0	2215	0.047	0.032	A0A8J8XYU9_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
17	P97479	1.73e-13	78.6	2215	0.047	0.032	MYO7A_MOUSE Unconventional myosin-VIIa OS=Mus musculus OX=10090 GN=Myo7a PE=1 SV=2
18	P91443	1.96e-13	78.6	2098	0.052	0.037	HUM6_CAEEL Unconventional myosin heavy chain 6 OS=Caenorhabditis elegans OX=6239 GN=hum-6 PE=1 SV=1
19	P54644	2.00e-12	73.6	444	0.025	0.083	KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum OX=44689 GN=pkbA PE=1 SV=1
20	Q86AC8	4.10e-12	73.9	3446	0.057	0.025	MYOG_DICDI Myosin-G heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoG PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00373 FERM_M	5e-09	48.0	FERM central domain
2	PF00784 MyTH4	9.5e-29	111.3	MyTH4 domain
3	PF00169 PH	2.2e-21	87.7	PH domain
4	PF15413 PH_11	0.12	24.3	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282406

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378332	0.862	Transforming growth factor beta-1-induced transcript 1 protein
2	9606.ENSP00000482306	0.672	Tetratricopeptide repeat protein 8
3	9606.ENSP00000312741	0.635	Calcium/calmodulin-dependent protein kinase kinase 2
4	9606.ENSP00000381101	0.630	Serpin B7
5	9606.ENSP00000282486	0.605	Muscleblind-like protein 1
6	9606.ENSP00000312185	0.602	Engulfment and cell motility protein 1
7	9606.ENSP00000456226	0.519	Interferon induced transmembrane protein domain containing
8	9606.ENSP00000278317	0.502	Troponin T, fast skeletal muscle

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.992	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0071840	0.967	cellular component organization or biogenesis
GO:0048523	0.902	negative regulation of cellular process
GO:0016043	0.892	cellular component organization
GO:0065008	0.667	regulation of biological quality
GO:0051128	0.589	regulation of cellular component organization
GO:0050896	0.416	response to stimulus
GO:0032501	0.376	multicellular organismal process
GO:0048856	0.321	anatomical structure development
GO:0043244	0.309	regulation of protein-containing complex disassembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0071944	0.999	cell periphery
GO:0016020	0.998	membrane
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005654	0.992	nucleoplasm
GO:0005886	0.985	plasma membrane
GO:0005829	0.968	cytosol
GO:0043232	0.911	intracellular non-membrane-bounded organelle
GO:0120025	0.709	plasma membrane bounded cell projection
GO:0005856	0.569	cytoskeleton
GO:0015629	0.458	actin cytoskeleton
GO:0016604	0.388	nuclear body
GO:0031252	0.322	cell leading edge

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]