StarFunc result for job id Q8IVF2

User Input

>input (1400 residues)
MCDCFHMVLPTWPGTPGSVSGRQLQPGEPGAETEDDHSVTEGPADEGIRPRPQGSSPVYE
YTTEAADFGLQEDAPGRQGSAGRRRSWWKRDSGDSRTFFRMSRPEAVQEATEVTLKTEVE
AGASGYSVTGGGDQGIFVKQVLKDSSAAKLFNLREGDQLLSTTVFFENIKYEDALKILQY
SEPYKVQFKIRRQLPAPQDEEWASSDAQHGPQGKEKEDTDVADGCRETPTKTLEGDGDQE
RLISKPRVGRGRQSQRERLSWPKFQSIKSKRGPGPQRSHSSSEAYEPRDAHDVSPTSTDT
EAQLTVERQEQKAGPGSQRRRKFLNLRFRTGSGQGPSSTGQPGRGFQSGVGRAGVLEELG
PWGDSLEETGAATGSRREERAEQDREVMPAQSMPLPTELGDPRLCEGTPQEGGLRAARLH
GKTLEGQAQETAVAQRKPRAQPTPGMSREGEGEGLQSLEIGIARLSLRDTTEGGTQIGPP
EIRVRVHDLKTPKFAFSTEKEPERERRLSTPQRGKRQDASSKAGTGLKGEEVEGAGWMPG
REPTTHAEAQGDEGDGEEGLQRTRITEEQDKGREDTEGQIRMPKFKIPSLGWSPSKHTKT
GREKATEDTEQGREGEATATADRREQRRTEEGLKDKEDSDSMTNTTKIQLIHDEKRLKKE
QILTEKEVATKDSKFKMPKFKMPLFGASAPGKSMEASVDVSAPKVEADVSLLSMQGDLKT
TDLSVQTPSADLEVQDGQVDVKLPEGPLPEGASLKGHLPKVQRPSLKMPKVDLKGPKLDL
KGPKAEVTAPDVKMSLSSMEVDVQAPRAKLDGARLEGDLSLADKEVTAKDSKFKMPKFKM
PSFGVSAPGKSMEDSVDVSAPKVEADVSLSSMQGDLKATDLSIQPPSADLEVQAGQVDVK
LPEGPVPEGAGPKVHLPKVEMPSFKMPKVDLKGPQIDVKGPKLDLKGPKAEVTAPDGEVS
LPSMEVDVQAQKAKLDGAWLEGDLSLADKDVTAKDSKFKMPKFKMPSFGVSAPGKSIKAL
VDVSAPKVEADLSLPSMQGDLKTTDLSIQPASTDLKVQADQVDVKLPEGHLPEGAGLKGH
LPKVEMPSFKMPKVALKGPQVDVKGPKLDLKSPKAEVTAPDVEVSLPSVEVDVEAPGAKL
DSARLEGELSLADKDVTAKDSRFKMPKFKMPSFGASAPGKSIEASVDVSAPKVEADVSLP
SMQGDLKTTDLSIQPPSADLEVHAGQVDVKLLEGHVPEGAGFKGHLPKVQMPSLKMPKVD
LKGPQVEVRGPKLDLKGHKAEVTAHEVAVSLPSVEVDMQAPGAKLDGAQLDGDLSLADKD
VTAKDSKFKMPKFKMPSFGVSAPGKSIEASVDLSAPKVEADMSLPSMQGDLKTTDLSIQP
PSTDLELQAGQLDVKLPEGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O55103	0.079	0.079	2.052E-15	1391	0.211	0.213	O55103.pdb.gz	PRAX_MOUSE Periaxin OS=Mus musculus OX=10090 GN=Prx PE=1 SV=1
2	AFDB:B4DTV0	0.066	0.080	7.724E-15	1079	0.204	0.265	B4DTV0.pdb.gz	B4DTV0_HUMAN cDNA FLJ57801, highly similar to Homo sapiens AHNAK nucleoprotein (desmoyokin) (AHNAK), transcript variant 1, mRNA (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
3	AFDB:Q9BXM0	0.066	0.064	5.244E-13	1461	0.206	0.198	Q9BXM0.pdb.gz	PRAX_HUMAN Periaxin OS=Homo sapiens OX=9606 GN=PRX PE=1 SV=2
4	AFDB:Q61484	0.039	0.043	7.245E-10	1231	0.222	0.253	Q61484.pdb.gz	Q61484_MOUSE Desmoyokin (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
5	AFDB:A0JLR7	0.032	0.038	4.361E-8	1069	0.209	0.273	A0JLR7.pdb.gz	A0JLR7_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
6	AFDB:Q9UMS6	0.051	0.064	2.163E-5	1093	0.144	0.185	Q9UMS6.pdb.gz	SYNP2_HUMAN Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2
7	AFDB:A0A0R4IS11	0.052	0.048	3.720E-5	1565	0.154	0.137	A0A0R4IS11.pdb.gz
8	AFDB:Q8BKS2	0.030	0.040	4.457E-5	939	0.146	0.218	Q8BKS2.pdb.gz	Q8BKS2_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=2
9	AFDB:Q9UPX8	0.046	0.045	5.672E-5	1470	0.146	0.139	Q9UPX8.pdb.gz	SHAN2_HUMAN SH3 and multiple ankyrin repeat domains protein 2 OS=Homo sapiens OX=9606 GN=SHANK2 PE=1 SV=4
10	AFDB:D4A702	0.049	0.054	1.101E-4	1262	0.151	0.167	D4A702.pdb.gz	SYNP2_RAT Synaptopodin-2 OS=Rattus norvegicus OX=10116 GN=Synpo2 PE=1 SV=2
11	PDB:7pc3A	0.046	0.140	1.023E-3	405	0.017	0.059	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
12	PDB:7p73A	0.044	0.132	2.526E-3	420	0.016	0.055	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
13	PDB:7qqmA	0.048	0.151	3.627E-3	413	0.019	0.065	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:5n7dA	0.047	0.144	1.540E-2	423	0.014	0.045	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
15	PDB:2xkxA	0.046	0.084	1.737E-2	721	0.016	0.031	2xkxA.pdb.gz
16	PDB:7pcbA	0.043	0.128	1.960E-2	415	0.014	0.046	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:6t36A	0.045	0.566	2.211E-2	93	0.014	0.215	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
18	PDB:7p70A	0.045	0.142	2.494E-2	407	0.014	0.047	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
19	PDB:7pe9I	0.044	0.179	2.649E-2	317	0.010	0.044	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
20	PDB:2l4tA	0.048	0.390	4.557E-2	124	0.016	0.177	2l4tA.pdb.gz	Promiscuous binding at the crossroads of numerous cancer pathways: insight from the binding of glutaminase interacting protein with glutaminase L.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A7N9VR94	0.0	774	3501	0.324	0.129	A0A7N9VR94_MOUSE AHNAK nucleoprotein 2 OS=Mus musculus OX=10090 GN=Ahnak2 PE=1 SV=1
2	Q8IVF2	0.0	1048	5795	0.398	0.096	AHNK2_HUMAN Protein AHNAK2 OS=Homo sapiens OX=9606 GN=AHNAK2 PE=1 SV=2
3	Q09666	5.81e-81	298	5890	0.206	0.049	AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2
4	E9Q616	8.60e-79	291	5656	0.214	0.053	E9Q616_MOUSE AHNAK nucleoprotein (desmoyokin) OS=Mus musculus OX=10090 GN=Ahnak PE=1 SV=1
5	A0PJF4	2.64e-75	278	1564	0.187	0.168	A0PJF4_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
6	A0JLR7	5.32e-69	255	1069	0.198	0.259	A0JLR7_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
7	Q61484	2.30e-68	255	1231	0.179	0.204	Q61484_MOUSE Desmoyokin (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
8	B4DTV0	1.83e-57	219	1079	0.160	0.208	B4DTV0_HUMAN cDNA FLJ57801, highly similar to Homo sapiens AHNAK nucleoprotein (desmoyokin) (AHNAK), transcript variant 1, mRNA (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
9	Q8BKS2	5.86e-45	179	939	0.158	0.235	Q8BKS2_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=2
10	Q8VDN3	1.60e-40	166	1024	0.138	0.188	Q8VDN3_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
11	Q8CGE7	1.54e-24	113	665	0.120	0.253	Q8CGE7_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
12	Q63425	1.88e-24	114	1383	0.035	0.035	PRAX_RAT Periaxin OS=Rattus norvegicus OX=10116 GN=Prx PE=1 SV=2
13	O55103	2.09e-24	114	1391	0.035	0.035	PRAX_MOUSE Periaxin OS=Mus musculus OX=10090 GN=Prx PE=1 SV=1
14	Q9BXM0	9.54e-24	112	1461	0.034	0.033	PRAX_HUMAN Periaxin OS=Homo sapiens OX=9606 GN=PRX PE=1 SV=2
15	Q8BRB8	2.98e-10	67.0	520	0.077	0.208	Q8BRB8_MOUSE PDZ domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
16	G5E8K8	4.23e-06	50.4	150	0.014	0.127	G5E8K8_MOUSE AHNAK nucleoprotein (desmoyokin) OS=Mus musculus OX=10090 GN=Ahnak PE=1 SV=1
17	Q8CEX7	4.35e-06	50.8	176	0.014	0.108	Q8CEX7_MOUSE PDZ domain-containing protein OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
18	Q8R2L7	4.67e-06	50.8	173	0.014	0.110	Q8R2L7_MOUSE Ahnak protein OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
19	A0A494B8Y7	6.11e-06	50.4	176	0.014	0.108	A0A494B8Y7_MOUSE AHNAK nucleoprotein (desmoyokin) OS=Mus musculus OX=10090 GN=Ahnak PE=1 SV=1
20	Q9BVU3	1.33e-05	48.9	150	0.014	0.127	Q9BVU3_HUMAN AHNAK protein OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13502 AsmA_2	2.6	19.1	AsmA-like C-terminal region
2	PF13349 DUF4097	5.4e-06	37.5	Putative adhesin
3	PF16223 DUF4882	29	15.4	Domain of unknown function (DUF4882)
4	PF00595 PDZ	0.13	23.9	PDZ domain
5	PF10458 Val_tRNA-synt_C	5.6e+02	12.3	Valyl tRNA synthetase tRNA binding arm

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353114

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367263	0.857	Neuroblast differentiation-associated protein AHNAK
2	9606.ENSP00000346032	0.844	Annexin A2
3	9606.ENSP00000357801	0.836	Protein S100-A10
4	9606.ENSP00000480958	0.558	Zinc finger protein 280B
5	9606.ENSP00000377941	0.555	Alpha-actinin-1
6	9606.ENSP00000355192	0.546	Voltage-dependent L-type calcium channel subunit alpha-1S
7	9606.ENSP00000222968	0.543	28 kDa heat- and acid-stable phosphoprotein
8	9606.ENSP00000352208	0.535	Myoferlin
9	9606.ENSP00000339191	0.533	Caveolin-1
10	9606.ENSP00000428280	0.528	Fer-1-like protein 6
11	9606.ENSP00000450114	0.518	Uncharacterized protein CLBA1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.898	biological regulation
GO:0050789	0.885	regulation of biological process
GO:0009987	0.695	cellular process
GO:0032501	0.524	multicellular organismal process
GO:0050794	0.518	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0071944	0.995	cell periphery
GO:0005886	0.991	plasma membrane
GO:0005829	0.913	cytosol
GO:0043226	0.571	organelle
GO:0043229	0.560	intracellular organelle
GO:0043227	0.490	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]