StarFunc result for job id Q8IVF4

User Input

>input (1400 residues)
MVPEEVEVEIDEIPVLSEEGEEEEETYSQKVESVDKVRAKRVSLRTESLGQPLNREDEEM
DKEISEKLPSKRTAKHIMEKMHLHMLCTPLPEEFLDQNVVFFLRNTKEAISEATDMKEAM
EIMPETLEYGIINANVLHFLKNIICQVFLPALSFNQHRTSTTVGVTSGEVSNSSEHESDL
PPMPGEAVEYHSIQLIRDEFLMNVQKFASNIQRTMQQLEGEIKLEMPIISVEGEVSDLAA
DPETVDILEQCVINWLNQISTAVEAQLKKTPQGKGPLAEIEFWRERNATLSALHEQTKLP
IVRKVLDVIKESDSMLVANLQPVFTELFKFHTEASDNVRFLSTVERYFKNITHGSGFHVV
LDTIPAMMSALRMVWIISRHYNKDERMIPLMERIAWEIAERVCRVVNLRTLFKENRASAQ
SKTLEARNTLRLWKKAYFDTRAKIEASGREDRWEFDRKRLFERTDYMATICQDLSDVLQI
LEEFYNIFGPELKAVTGDPKRIDDVLCRVDGLVTPMENLTFDPFSIKSSQFWKYVMDEFK
IEVLIDIINKIFVQNLENPPLYKNHPPVAGAIYWERSLFFRIKHTILRFQEVQEILDSDR
GQEVKQKYLEVGRTMKEYEDRKYEQWMEVTEQVLPALMKKSLLTKSSIATEEPSTLERGA
VFAINFSPALREIINETKYLEQLGFTVPELARNVALQEDKFLRYTAGIQRMLDHYHMLIG
TLNDAESVLLKDHSQELLRVFRSGYKRLNWNSLGIGDYITGCKQAIGKFESLVHQIHKNA
DDISSRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHMVRWYLAIGPLLT
KVEGLVVHTNTGKAPKLASYYKYWEKKIYEVLTKLILKNLQSFNSLILGNVPLFHTETIL
TAPEIILHPNTNEIDKMCFHCVRNCVEITKHFVRWMNGSCIECPPQKGEEEEVVIINFYN
DISLNPQIIEQAVMIPQNVHRILINLMKYLQKWKRYRPLWKLDKAIVMEKFAAKKPPCVA
YDEKLQFYSKIAYEVMRHPLIKDEHCIRLQLRHLANTVQENAKSWVISLGKLLNESAKEE
LYNLHEEMEHLAKNLRKIPNTLEDLKFVLATIAEIRSKSLVMELRYRDVQERYRTMAMYN
LFPPDAEKELVDKIESIWSNLFNDSVNVEHALGDIKRTFTELTRGEIMNYRVQIEEFAKR
FYSEGPGSVGDDLDKGVELLGVYERELARHEKSRQELANAEKLFDLPITMYPELLKVQKE
MSGLRMIYELYEGLKVAKEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYY
LEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEKTSVFFEMTETFTLENMFAMELHKHTD
VLNEIVTAAIKEVAIEKAVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7z8fe	0.272	0.110	2.956E-32	4579	0.151	0.046	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
2	PDB:7kzmC	0.224	0.090	1.711E-15	3890	0.145	0.052	7kzmC.pdb.gz	Structure of a microtubule-bound axonemal dynein.
3	AFDB:A0A0R4IUQ6	0.214	0.428	4.786E-13	614	0.071	0.163	A0A0R4IUQ6.pdb.gz
4	PDB:7z8jf	0.171	0.312	7.610E-12	674	0.073	0.151	7z8jf.pdb.gz
5	AFDB:Q5SX07	0.189	0.514	8.413E-11	457	0.059	0.182	Q5SX07.pdb.gz	Q5SX07_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
6	AFDB:G5EG51	0.061	0.065	3.102E-4	1270	0.103	0.113	G5EG51.pdb.gz	NRDE2_CAEEL Nuclear exosome regulator NRDE2 OS=Caenorhabditis elegans OX=6239 GN=nrde-2 PE=1 SV=1
7	AFDB:F5HSE3	0.081	0.061	3.529E-4	2381	0.132	0.078	F5HSE3.pdb.gz	NIPLA_DANRE Nipped-B-like protein A OS=Danio rerio OX=7955 GN=nipbla PE=2 SV=1
8	PDB:7jq9A	0.070	0.049	9.596E-4	2427	0.100	0.058	7jq9A.pdb.gz
9	AFDB:Q8GX37	0.062	0.092	1.342E-3	782	0.055	0.098	Q8GX37.pdb.gz	FH9_ARATH Formin-like protein 9 OS=Arabidopsis thaliana OX=3702 GN=FH9 PE=2 SV=2
10	PDB:6bcuA	0.073	0.056	1.680E-3	2204	0.106	0.068	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
11	AFDB:Q8JGN7	0.079	0.528	2.250E-3	202	0.026	0.178	Q8JGN7.pdb.gz
12	PDB:7wo9A	0.074	0.068	2.271E-3	1581	0.108	0.096	7wo9A.pdb.gz
13	AFDB:Q5TJ57	0.076	0.072	2.349E-3	1561	0.109	0.098	Q5TJ57.pdb.gz	FORE_DICDI Formin-E OS=Dictyostelium discoideum OX=44689 GN=forE PE=1 SV=1
14	AFDB:Q75E93	0.069	0.125	3.461E-3	561	0.054	0.135	Q75E93.pdb.gz	Q75E93_EREGS AAR187Cp OS=Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=AGOS_AAR187C PE=1 SV=1
15	PDB:6q82A	0.078	0.092	3.808E-3	1027	0.098	0.133	6q82A.pdb.gz	Structural basis for the nuclear import and export functions of the biportin Pdr6/Kap122.
16	PDB:7mqaSP	0.075	0.059	4.151E-3	2485	0.104	0.058	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7sx3E	0.060	0.055	4.334E-3	1611	0.111	0.096	7sx3E.pdb.gz	Structural architecture of the human NALCN channelosome.
18	PDB:7ktsA	0.071	0.048	5.859E-3	3042	0.112	0.052	7ktsA.pdb.gz
19	AFDB:O14207	0.075	0.062	7.516E-3	1888	0.120	0.089	O14207.pdb.gz	MMS22_SCHPO Protein mms22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mus7 PE=3 SV=1
20	AFDB:Q7JP75	0.081	0.080	1.108E-2	1437	0.098	0.095	Q7JP75.pdb.gz	Q7JP75_CAEEL WAPL domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cyk-1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YYQ8	0.0	2216	4591	0.770	0.235	D3YYQ8_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
2	E7FGT8	0.0	1373	4626	0.503	0.152	E7FGT8_DANRE Dynein heavy chain 10, axonemal OS=Danio rerio OX=7955 GN=si:dkeyp-86b9.1 PE=1 SV=2
3	F7ABZ6	0.0	2283	4534	0.779	0.240	F7ABZ6_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
4	Q9SMH3	0.0	823	4625	0.345	0.104	DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1
5	Q580B5	5.85e-167	559	4448	0.284	0.089	Q580B5_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5E12.710 PE=4 SV=1
6	Q9VAV5	1.11e-127	442	5080	0.172	0.047	Q9VAV5_DROME Dynein heavy chain at 89D, isoform B OS=Drosophila melanogaster OX=7227 GN=Dhc98D PE=3 SV=3
7	Q96JB1	5.52e-73	272	4490	0.224	0.070	DYH8_HUMAN Dynein axonemal heavy chain 8 OS=Homo sapiens OX=9606 GN=DNAH8 PE=1 SV=2
8	Q39575	1.95e-72	271	4485	0.191	0.060	DYHG_CHLRE Dynein gamma chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 GN=ODA2 PE=1 SV=1
9	Q9MBF8	2.17e-70	264	4513	0.215	0.067	DYH1B_CHLRE Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC10 PE=1 SV=1
10	Q57WX6	2.37e-69	261	4639	0.217	0.066	Q57WX6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.490 PE=4 SV=1
11	B1AR51	6.86e-52	204	4484	0.198	0.062	B1AR51_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
12	Q9UFH2	3.50e-51	202	4462	0.194	0.061	DYH17_HUMAN Dynein axonemal heavy chain 17 OS=Homo sapiens OX=9606 GN=DNAH17 PE=1 SV=3
13	F1SC07	5.79e-45	182	4518	0.189	0.058	DYH11_PIG Dynein axonemal heavy chain 11 OS=Sus scrofa OX=9823 GN=DNAH11 PE=1 SV=4
14	Q9NYC9	6.24e-44	178	4486	0.187	0.058	DYH9_HUMAN Dynein axonemal heavy chain 9 OS=Homo sapiens OX=9606 GN=DNAH9 PE=1 SV=3
15	E9Q7N9	6.94e-42	171	4488	0.180	0.056	E9Q7N9_MOUSE Dynein, axonemal, heavy chain 11 OS=Mus musculus OX=10090 GN=Dnah11 PE=1 SV=2
16	Q9QZH1	3.24e-41	169	4488	0.181	0.056	Q9QZH1_MOUSE Left-right dynein OS=Mus musculus OX=10090 GN=Dnah11 PE=2 SV=1
17	Q96DT5	5.47e-41	169	4516	0.189	0.059	DYH11_HUMAN Dynein axonemal heavy chain 11 OS=Homo sapiens OX=9606 GN=DNAH11 PE=1 SV=4
18	Q69Z23	2.40e-40	166	4481	0.131	0.041	DYH17_MOUSE Dynein axonemal heavy chain 17 OS=Mus musculus OX=10090 GN=Dnah17 PE=1 SV=2
19	A0A0B4LH20	3.50e-39	162	4724	0.090	0.027	A0A0B4LH20_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Dhc1 PE=3 SV=1
20	Q8VHE6	8.12e-39	161	4621	0.122	0.037	DYH5_MOUSE Dynein axonemal heavy chain 5 OS=Mus musculus OX=10090 GN=Dnah5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08385 DHC_N1	1.7e-124	428.2	Dynein heavy chain, N-terminal region 1
2	PF08393 DHC_N2	1.8e-24	98.2	Dynein heavy chain, N-terminal region 2
3	PF06840 DUF1241	1.5e+02	13.5	Protein of unknown function (DUF1241)
4	PF07796 DUF1638	7.1e+02	11.5	Protein of unknown function (DUF1638)
5	PF17676 Peptidase_S66C	2.2e+02	13.8	LD-carboxypeptidase C-terminal domain
6	PF07093 SGT1	42	14.1	SGT1 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386770

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354791	0.878	Dynactin subunit 1
2	9606.ENSP00000408910	0.875	Dynactin subunit 2
3	9606.ENSP00000254286	0.820	Actin related protein 10 homolog
4	9606.ENSP00000289228	0.820	Beta-centractin
5	9606.ENSP00000358921	0.820	Alpha-centractin
6	9606.ENSP00000414906	0.807	Dynactin subunit 4
7	9606.ENSP00000334002	0.804	Huntingtin-associated protein 1
8	9606.ENSP00000259632	0.803	Dynactin subunit 3
9	9606.ENSP00000300087	0.801	Dynactin subunit 5
10	9606.ENSP00000221114	0.800	Dynactin subunit 6
11	9606.ENSP00000294664	0.748	WD repeat-containing protein 63
12	9606.ENSP00000357575	0.743	Cilia- and flagella-associated protein 46
13	9606.ENSP00000238156	0.706	Coiled-coil domain containing 92
14	9606.ENSP00000474529	0.704	GAS2-like protein 2
15	9606.ENSP00000441405	0.686	Zinc finger protein 664
16	9606.ENSP00000216068	0.660	Dynein light chain 4, axonemal
17	9606.ENSP00000462435	0.632	Tubulin polymerization-promoting protein family member 3
18	9606.ENSP00000337946	0.629	Parkin coregulated gene protein
19	9606.ENSP00000270142	0.601	Superoxide dismutase [Cu-Zn]
20	9606.ENSP00000312554	0.569	Dynein axonemal heavy chain 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003777	1.000	microtubule motor activity
GO:0005515	0.987	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007017	0.989	microtubule-based process
GO:0003341	0.713	cilium movement

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005856	0.999	cytoskeleton
GO:0005929	0.998	cilium
GO:0032991	0.982	protein-containing complex
GO:0032838	0.979	plasma membrane bounded cell projection cytoplasm
GO:0005930	0.964	axoneme
GO:1902494	0.788	catalytic complex
GO:0015630	0.709	microtubule cytoskeleton
GO:0031514	0.604	motile cilium
GO:0005875	0.530	microtubule associated complex
GO:0030286	0.514	dynein complex
GO:0005858	0.332	axonemal dynein complex
GO:0097729	0.317	9+2 motile cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]