StarFunc result for job id Q8IVF5

User Input

>input (1701 residues)
MGNSDSQYTLQGSKNHSNTITGAKQIPCSLKIRGIHAKEEKSLHGWGHGSNGAGYKSRSL
ARSCLSHFKSNQPYASRLGGPTCKVSRGVAYSTHRTNAPGKDFQGISAAFSTENGFHSVG
HELADNHITSRDCNGHLLNCYGRNESIASTPPGEDRKSPRVLIKTLGKLDGCLRVEFHNG
GNPSKVPAEDCSEPVQLLRYSPTLASETSPVPEARRGSSADSLPSHRPSPTDSRLRSSKG
SSLSSESSWYDSPWGNAGELSEAEGSFLAPGMPDPSLHASFPPGDAKKPFNQSSSLSSLR
ELYKDANLGSLSPSGIRLSDEYMGTHASLSNRVSFASDIDVPSRVAHGDPIQYSSFTLPC
RKPKAFVEDTAKKDSLKARMRRISDWTGSLSRKKRKLQEPRSKEGSDYFDSRSDGLNTDV
QGSSQASAFLWSGGSTQILSQRSESTHAIGSDPLRQNIYENFMRELEMSRTNTENIETST
ETAESSSESLSSLEQLDLLFEKEQGVVRKAGWLFFKPLVTVQKERKLELVARRKWKQYWV
TLKGCTLLFYETYGKNSMDQSSAPRCALFAEDSIVQSVPEHPKKENVFCLSNSFGDVYLF
QATSQTDLENWVTAVHSACASLFAKKHGKEDTLRLLKNQTKNLLQKIDMDSKMKKMAELQ
LSVVSDPKNRKAIENQIQQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAAASRPS
KLALGRLGILSVSSFHALVCSRDDSALRKRTLSLTQRGRNKKGIFSSLKGLDTLARKGKE
KRPSITQVDELLHIYGSTVDGVPRDNAWEIQTYVHFQDNHGVTVGIKPEHRVEDILTLAC
KMRQLEPSHYGLQLRKLVDDNVEYCIPAPYEYMQQQVYDEIEVFPLNVYDVQLTKTGSVC
DFGFAVTAQVDERQHLSRIFISDVLPDGLAYGEGLRKGNEIMTLNGEAVSDLDLKQMEAL
FSEKSVGLTLIARPPDTKATLCTSWSDSDLFSRDQKSLLPPPNQSQLLEEFLDNFKKNTA
NDFSNVPDITTGLKRSQTDGTLDQVSHREKMEQTFRSAEQITALCRSFNDSQANGMEGPR
ENQDPPPRSLARHLSDADRLRKVIQELVDTEKSYVKDLSCLFELYLEPLQNETFLTQDEM
ESLFGSLPEMLEFQKVFLETLEDGISASSDFNTLETPSQFRKLLFSLGGSFLYYADHFKL
YSGFCANHIKVQKVLERAKTDKAFKAFLDARNPTKQHSSTLESYLIKPVQRVLKYPLLLK
ELVSLTDQESEEHYHLTEALKAMEKVASHINEMQKIYEDYGTVFDQLVAEQSGTEKEVTE
LSMGELLMHSTVSWLNPFLSLGKARKDLELTVFVFKRAVILVYKENCKLKKKLPSNSRPA
HNSTDLDPFKFRWLIPISALQVRLGNPAGTENNSIWELIHTKSEIEGRPETIFQLCCSDS
ESKTNIVKVIRSILRENFRRHIKCELPLEKTCKDRLVPLKNRVPVSAKLASSRSLKVLKN
SSSNEWTGETGKGTLLDSDEGSLSSGTQSSGCPTAEGRQDSKSTSPGKYPHPGLADFADN
LIKESDILSDEDDDHRQTVKQGSPTKDIEIQFQRLRISEDPDVHPEAEQQPGPESGEGQK
GGEQPKLVRGHFCPIKRKANSTKRDRGTLLKAQIRHQSLDSQSENATIDLNSVLEREFSV
QSLTSVVSEECFYETESHGKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZPF3	0.286	0.284	0.000	1715	0.844	0.837	Q6ZPF3.pdb.gz	TIAM2_MOUSE Rho guanine nucleotide exchange factor TIAM2 OS=Mus musculus OX=10090 GN=Tiam2 PE=1 SV=2
2	AFDB:Q8IVF5	1.000	1.000	0.000	1701	1.000	1.000	Q8IVF5.pdb.gz	TIAM2_HUMAN Rho guanine nucleotide exchange factor TIAM2 OS=Homo sapiens OX=9606 GN=TIAM2 PE=2 SV=4
3	AFDB:Q13009	0.254	0.269	3.701E-99	1591	0.370	0.396	Q13009.pdb.gz	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2
4	AFDB:P91620	0.304	0.259	1.194E-83	2061	0.290	0.239	P91620.pdb.gz	SIF2_DROME Protein still life, isoforms C/SIF type 2 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
5	AFDB:Q96PE2	0.140	0.122	3.107E-20	2063	0.153	0.127	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
6	AFDB:Q9VW85	0.122	0.124	6.520E-17	1661	0.142	0.145	Q9VW85.pdb.gz	Q9VW85_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG13812 PE=1 SV=4
7	PDB:4mt6A	0.128	0.447	1.825E-15	389	0.045	0.195	4mt6A.pdb.gz
8	AFDB:Q9VZ85	0.125	0.108	3.760E-15	1984	0.130	0.111	Q9VZ85.pdb.gz	Q9VZ85_DROME Rho guanine nucleotide exchange factor at 64C, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGEF64C PE=4 SV=2
9	AFDB:Q12774	0.120	0.126	1.190E-14	1597	0.121	0.129	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
10	PDB:7rx9A	0.105	0.391	1.827E-14	432	0.055	0.218	7rx9A.pdb.gz
11	AFDB:Q6ZNL6	0.104	0.119	3.948E-13	1462	0.116	0.135	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
12	AFDB:Q54YZ6	0.123	0.155	3.958E-11	1218	0.087	0.122	Q54YZ6.pdb.gz	Q54YZ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=gxcA PE=4 SV=1
13	PDB:4gouA	0.095	0.294	1.162E-8	507	0.036	0.122	4gouA.pdb.gz
14	PDB:6bbpA	0.055	0.169	4.242E-4	520	0.018	0.058	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
15	PDB:6u3eA	0.051	0.206	8.468E-4	397	0.016	0.071	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
16	PDB:6hhgA	0.051	0.214	9.723E-4	386	0.012	0.052	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
17	PDB:7p73A	0.048	0.185	1.690E-3	420	0.014	0.055	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
18	PDB:3ljuX	0.057	0.233	1.941E-3	373	0.011	0.051	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
19	PDB:6s9wA	0.052	0.201	2.032E-3	411	0.012	0.051	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
20	PDB:7pc3A	0.049	0.188	2.938E-3	405	0.010	0.042	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AC12	0.0	982	1590	0.354	0.379	A0A8I6AC12_RAT TIAM Rac1 associated GEF 1 OS=Rattus norvegicus OX=10116 GN=Tiam1 PE=4 SV=1
2	D3ZWV8	0.0	948	1588	0.349	0.374	D3ZWV8_RAT TIAM Rac1 associated GEF 1 OS=Rattus norvegicus OX=10116 GN=Tiam1 PE=1 SV=4
3	P91620	0.0	676	2061	0.226	0.187	SIF2_DROME Protein still life, isoforms C/SIF type 2 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
4	Q13009	0.0	987	1591	0.352	0.376	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2
5	Q60610	0.0	988	1591	0.353	0.378	TIAM1_MOUSE Rho guanine nucleotide exchange factor TIAM1 OS=Mus musculus OX=10090 GN=Tiam1 PE=1 SV=1
6	Q6ZPF3	0.0	2816	1715	0.844	0.837	TIAM2_MOUSE Rho guanine nucleotide exchange factor TIAM2 OS=Mus musculus OX=10090 GN=Tiam2 PE=1 SV=2
7	Q8IVF5	0.0	3521	1701	1.000	1.000	TIAM2_HUMAN Rho guanine nucleotide exchange factor TIAM2 OS=Homo sapiens OX=9606 GN=TIAM2 PE=2 SV=4
8	A0A8I6G1W3	5.37e-165	516	622	0.169	0.463	A0A8I6G1W3_RAT TIAM Rac1 associated GEF 1 OS=Rattus norvegicus OX=10116 GN=Tiam1 PE=4 SV=1
9	P91621	2.15e-103	370	2072	0.106	0.087	SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
10	Q5JYA6	3.14e-26	120	1385	0.052	0.064	Q5JYA6_HUMAN PLEKHG1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=2 SV=1
11	Q9ULL1	3.14e-26	120	1385	0.052	0.064	PKHG1_HUMAN Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=1 SV=2
12	O01847	1.14e-24	114	889	0.054	0.103	O01847_CAEEL DH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tiam-1 PE=4 SV=3
13	Q3LAC4	2.09e-23	111	1598	0.062	0.066	PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus OX=10090 GN=Prex2 PE=1 SV=2
14	Q9TW28	3.51e-22	107	1737	0.044	0.043	MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoM PE=1 SV=1
15	Q70Z35	5.51e-22	106	1606	0.059	0.062	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
16	F1Q628	3.85e-21	101	514	0.043	0.142	F1Q628_DANRE Rho guanine nucleotide exchange factor 9 OS=Danio rerio OX=7955 GN=arhgef9 PE=4 SV=1
17	A0A024RDM6	1.30e-20	100	652	0.041	0.107	A0A024RDM6_HUMAN SPATA13 (Fragment) OS=Homo sapiens OX=9606 GN=SPATA13 PE=4 SV=1
18	Q8TCU6	1.30e-20	102	1659	0.046	0.048	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
19	Q96N96	1.30e-20	100	652	0.041	0.107	SPT13_HUMAN Spermatogenesis-associated protein 13 OS=Homo sapiens OX=9606 GN=SPATA13 PE=1 SV=1
20	A0A0A6YYF8	1.47e-20	100	564	0.048	0.145	A0A0A6YYF8_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20570 DUF6779	8.2e+02	12.1	Domain of unknown function (DUF6779)
2	PF00595 PDZ	0.0015	30.2	PDZ domain
3	PF02163 Peptidase_M50	2.4e+02	12.3	Peptidase family M50
4	PF00169 PH	1.1e-13	62.9	PH domain
5	PF16652 PH_13	1.7e+02	13.5	Pleckstrin homology domain
6	PF15406 PH_6	1.2e+02	14.4	Pleckstrin homology domain
7	PF15410 PH_9	1.1e-05	37.0	Pleckstrin homology domain
8	PF02196 RBD	8.4	17.7	Raf-like Ras-binding domain
9	PF00621 RhoGEF	7.3e-43	158.4	RhoGEF domain
10	PF18385 Tiam_CC_Ex	4.6e-19	79.6	T-lymphoma invasion and metastasis CC-Ex domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437188

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348461	0.946	Ras-related C3 botulinum toxin substrate 1
2	9606.ENSP00000417401	0.904	Helicase with zinc finger domain 2
3	9606.ENSP00000262367	0.903	CREB-binding protein
4	9606.ENSP00000399968	0.902	Nuclear receptor coactivator 2
5	9606.ENSP00000457466	0.901	Chromodomain-helicase-DNA-binding protein 9
6	9606.ENSP00000217964	0.900	F-box-like/WD repeat-containing protein TBL1X
7	9606.ENSP00000260129	0.900	Trimethylguanosine synthase
8	9606.ENSP00000262188	0.900	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
9	9606.ENSP00000300651	0.900	Mediator of RNA polymerase II transcription subunit 1
10	9606.ENSP00000325690	0.900	Histone-arginine methyltransferase CARM1
11	9606.ENSP00000363929	0.900	Nuclear receptor coactivator 6
12	9606.ENSP00000385216	0.900	Nuclear receptor coactivator 1
13	9606.ENSP00000385523	0.900	Peroxisome proliferator-activated receptor alpha
14	9606.ENSP00000405574	0.900	F-box-like/WD repeat-containing protein TBL1XR1
15	9606.ENSP00000419692	0.900	Retinoic acid receptor RXR-alpha
16	9606.ENSP00000383118	0.732	Cell division control protein 42 homolog
17	9606.ENSP00000237172	0.678	Filamin-A-interacting protein 1
18	9606.ENSP00000230461	0.669	Cell cycle control protein 50A
19	9606.ENSP00000295834	0.650	Fatty acid-binding protein, liver
20	9606.ENSP00000159060	0.641	NADPH oxidase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0023051	0.968	regulation of signaling
GO:0010646	0.968	regulation of cell communication
GO:0048583	0.959	regulation of response to stimulus
GO:0009966	0.952	regulation of signal transduction
GO:1902531	0.921	regulation of intracellular signal transduction
GO:0051056	0.912	regulation of small GTPase mediated signal transduction
GO:0009987	0.857	cellular process
GO:0048518	0.789	positive regulation of biological process
GO:0048522	0.696	positive regulation of cellular process
GO:0050896	0.586	response to stimulus
GO:0051716	0.532	cellular response to stimulus
GO:0007165	0.479	signal transduction
GO:0019222	0.414	regulation of metabolic process
GO:0060255	0.309	regulation of macromolecule metabolic process
GO:0080090	0.307	regulation of primary metabolic process
GO:0051171	0.302	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005829	0.995	cytosol
GO:0016020	0.991	membrane
GO:0005576	0.984	extracellular region
GO:0043229	0.975	intracellular organelle
GO:0043231	0.969	intracellular membrane-bounded organelle
GO:0031982	0.916	vesicle
GO:0071944	0.909	cell periphery
GO:0005886	0.897	plasma membrane
GO:0070062	0.888	extracellular exosome
GO:0005634	0.363	nucleus
GO:0097708	0.349	intracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]