StarFunc result for job id Q8IVF6

User Input

>input (992 residues)
MRKLFSFGRRLGQALLSSMDQEYAGPGYDIRDWELRKIHRAAIKGDAAEVERCLTRRFRD
LDARDRKDRTVLHLACAHGRVQVVTLLLHRRCQIDICDRLNRTPLMKAVHSQEEACAIVL
LECGANPNIEDIYGNTALHYAVYNKGTSLAERLLSHHANIEALNKEGNTPLLFAINSRRQ
HMVEFLLKNQANIHAVDNFKRTALILAVQHNLSSIVTLLLQQNIRISSQDMFGQTAEDYA
LCSDLRSIRQQILEHKNKMLKNHLRNDNQETAAMKPANLKKRKERAKAEHNLKVASEEKQ
ERLQRSENKQPQDSQSYGKKKDAMYGNFMLKKDIAMLKEELYAIKNDSLRKEKKYIQEIK
SITEINANFEKSVRLNEKMITKTVARYSQQLNDLKAENARLNSELEKEKHNKERLEAEVE
SLHSSLATAINEYNEIVERKDLELVLWRADDVSRHEKMGSNISQLTDKNELLTEQVHKAR
VKFNTLKGKLRETRDALREKTLALGSVQLDLRQAQHRIKEMKQMHPNGEAKESQSIGKQN
SLEERIRQQELENLLLERQLEDARKEGDNKEIVINIHRDCLENGKEDLLEERNKELMKEY
NYLKEKLLQCEKEKAEREVIVREFQEELVDHLKTFSISESPLEGTSHCHINLNETWTSKK
KLFQVEIQPEEKHEEFRKLFELISLLNYTADQIRKKNRELEEEATGYKKCLEMTINMLNA
FANEDFSCHGDLNTDQLKMDILFKKLKQKFNDLVAEKEAVSSECVNLAKDNEVLHQELLS
MRNVQEKCEKLEKDKKMLEEEVLNLKTHMEKDMVELGKLQEYKSELDERAVQEIEKLEEI
HLQKQAEYEKQLEQLNKDNTASLKKKELTLKDVECKFSKMKTAYEEVTTELEEFKEAFAG
AVKANNSMSKKLMKSDKKIAVISTKLFTEKQRMKYFLSTLPTRPEPELPCVENLNSIELN
RKYIPKTAIRIPTSNPQTSNNCKNFLTEVLLC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TYW2	0.262	0.314	3.054E-36	823	0.331	0.399	Q5TYW2.pdb.gz	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
2	AFDB:Q9UPS8	0.223	0.137	6.330E-28	1710	0.457	0.265	Q9UPS8.pdb.gz	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
3	AFDB:A0JP26	0.250	0.422	6.239E-24	581	0.154	0.263	A0JP26.pdb.gz	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
4	AFDB:A5A3E0	0.247	0.228	4.046E-23	1075	0.130	0.120	A5A3E0.pdb.gz	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
5	AFDB:A1A5B0	0.228	0.718	1.462E-21	309	0.131	0.421	A1A5B0.pdb.gz	A1A5B0_HUMAN ANKRD36 protein OS=Homo sapiens OX=9606 GN=ANKRD36 PE=1 SV=1
6	AFDB:Q9D504	0.236	0.813	2.190E-21	279	0.106	0.376	Q9D504.pdb.gz	ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus OX=10090 GN=Ankrd7 PE=2 SV=2
7	AFDB:Q811D2	0.183	0.117	5.171E-21	1581	0.373	0.234	Q811D2.pdb.gz	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
8	AFDB:C9JIJ7	0.213	0.749	1.095E-18	263	0.099	0.373	C9JIJ7.pdb.gz	C9JIJ7_HUMAN Ankyrin repeat domain 7 OS=Homo sapiens OX=9606 GN=ANKRD7 PE=1 SV=2
9	AFDB:Q6NSI1	0.172	0.516	7.417E-16	321	0.091	0.280	Q6NSI1.pdb.gz	AR26L_HUMAN Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens OX=9606 GN=ANKRD26P1 PE=5 SV=2
10	AFDB:Q8CGB3	0.218	0.154	3.119E-14	1411	0.195	0.137	Q8CGB3.pdb.gz	UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus OX=10090 GN=Uaca PE=1 SV=2
11	PDB:2dvwA	0.210	0.849	1.055E-12	229	0.054	0.236	2dvwA.pdb.gz
12	PDB:8cs9A	0.192	0.235	5.590E-12	796	0.065	0.080	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
13	PDB:4oauC	0.204	0.288	1.736E-10	692	0.061	0.088	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:6v9hC	0.198	0.694	2.171E-9	270	0.043	0.159	6v9hC.pdb.gz
15	PDB:6aunA	0.179	0.267	3.599E-9	618	0.057	0.092	6aunA.pdb.gz
16	PDB:5vkqA	0.205	0.138	5.126E-9	1499	0.059	0.039	5vkqA.pdb.gz
17	PDB:1wg0A	0.206	0.774	6.941E-9	243	0.047	0.193	1wg0A.pdb.gz
18	PDB:6jd6B	0.147	0.705	2.582E-8	192	0.045	0.234	6jd6B.pdb.gz
19	PDB:6dmwA	0.183	0.283	1.063E-7	631	0.050	0.079	6dmwA.pdb.gz	Structural insights on TRPV5 gating by endogenous modulators.
20	PDB:6mwqA	0.150	0.296	1.176E-7	493	0.047	0.095	6mwqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5TYW2	3.54e-106	351	823	0.163	0.197	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
2	Q811D2	1.99e-99	345	1581	0.264	0.166	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
3	Q9UPS8	4.38e-89	315	1710	0.261	0.151	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
4	A1A5B0	2.86e-70	238	309	0.128	0.411	A1A5B0_HUMAN ANKRD36 protein OS=Homo sapiens OX=9606 GN=ANKRD36 PE=1 SV=1
5	A0JP26	1.04e-66	237	581	0.133	0.227	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
6	Q8N2N9	3.44e-66	245	1353	0.127	0.093	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
7	P0CG39	3.82e-65	240	1038	0.131	0.125	POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens OX=9606 GN=POTEJ PE=3 SV=1
8	A5A3E0	7.94e-65	240	1075	0.130	0.120	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
9	P0CG38	8.79e-65	239	1075	0.131	0.121	POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens OX=9606 GN=POTEI PE=3 SV=1
10	Q6S8J3	1.16e-64	239	1075	0.130	0.120	POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens OX=9606 GN=POTEE PE=2 SV=3
11	Q9D504	1.99e-61	212	279	0.104	0.369	ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus OX=10090 GN=Ankrd7 PE=2 SV=2
12	A0A140VJE5	1.00e-54	192	254	0.102	0.398	A0A140VJE5_HUMAN Testicular tissue protein Li 19 OS=Homo sapiens OX=9606 PE=2 SV=1
13	Q92527	1.00e-54	192	254	0.102	0.398	ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens OX=9606 GN=ANKRD7 PE=2 SV=3
14	C9JIJ7	4.04e-54	191	263	0.102	0.384	C9JIJ7_HUMAN Ankyrin repeat domain 7 OS=Homo sapiens OX=9606 GN=ANKRD7 PE=1 SV=2
15	Q6NSI1	6.44e-54	192	321	0.098	0.302	AR26L_HUMAN Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens OX=9606 GN=ANKRD26P1 PE=5 SV=2
16	Q54KA7	1.12e-21	103	986	0.070	0.070	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
17	H0YNH8	7.48e-17	88.6	1401	0.057	0.041	H0YNH8_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=1
18	F1M5N3	8.06e-17	89.0	3966	0.067	0.017	F1M5N3_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4
19	Q9BZF9	8.10e-17	88.6	1416	0.057	0.040	UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=2
20	A0A5F9ZHT8	9.53e-17	88.6	3891	0.067	0.017	A0A5F9ZHT8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.5e-17	74.3	Ankyrin repeat
2	PF12796 Ank_2	7.5e-23	92.2	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	8.3e-13	58.1	Ankyrin repeat
4	PF13637 Ank_4	1e-19	81.8	Ankyrin repeats (many copies)
5	PF13857 Ank_5	6.7e-19	79.0	Ankyrin repeats (many copies)
6	PF16523 betaPIX_CC	22	16.4	betaPIX coiled coil
7	PF14915 CCDC144C	1.1e-93	325.4	CCDC144C protein coiled-coil region
8	PF12001 DUF3496	1.9e-29	113.6	Domain of unknown function (DUF3496)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382610

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267425	0.564	Nucleolar protein 9
2	9606.ENSP00000375770	0.527	Zinc finger protein 541

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0050794	0.931	regulation of cellular process
GO:0009987	0.894	cellular process
GO:0051128	0.592	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.996	intracellular organelle
GO:0043227	0.977	membrane-bounded organelle
GO:0005634	0.974	nucleus
GO:0043232	0.968	intracellular non-membrane-bounded organelle
GO:0005654	0.870	nucleoplasm
GO:0005886	0.800	plasma membrane
GO:0005737	0.353	cytoplasm
GO:0005856	0.340	cytoskeleton
GO:0005829	0.332	cytosol
GO:0015630	0.309	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]