StarFunc result for job id Q8IVF7

User Input

>input (1028 residues)
MGNLESAEGVPGEPPSVPLLLPPGKMPMPEPCELEERFALVLSSMNLPPDKARLLRQYDN
EKKWDLICDQERFQVKNPPHTYIQKLQSFLDPSVTRKKFRRRVQESTKVLRELEISLRTN
HIGWVREFLNDENKGLDVLVDYLSFAQCSVMFDFEGLESGDDGAFDKLRSWSRSIEDLQP
PSALSAPFTNSLARSARQSVLRYSTLPGRRALKNSRLVSQKDDVHVCILCLRAIMNYQYG
FNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILAAFDNFKEVCKEL
HRFEKLMEYFRNEDSNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLEEFLQKSR
HTESEKLQVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHVSHLTEKLLDLENENM
MRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLES
VDSEALARVGPAELSEGMPPSDLDLLAPAPPPEEVLPLPPPPAPPLPPPPPPLPDKCPPA
PPLPGAAPSVVLTVGLSAIRIKKPIKTKFRLPVFNWTALKPNQISGTVFSELDDEKILED
LDLDKFEELFKTKAQGPALDLICSKNKTAQKAASKVTLLEANRAKNLAITLRKAGRSAEE
ICRAIHTFDLQTLPVDFVECLMRFLPTEAEVKLLRQYERERQPLEELAAEDRFMLLFSKV
ERLTQRMAGMAFLGNFQDNLQMLTPQLNAIIAASASVKSSQKLKQMLEIILALGNYMNSS
KRGAVYGFKLQSLDLLLDTKSTDRKMTLLHFIALTVKEKYPDLANFWHELHFVEKAAAVS
LENVLLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVR
YFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPS
QRNKWQQQELIAELRRRQAKEHRPVYEGKDGTIEDIITVLKSVPFTARTAKRGSRFFCDA
AHHDESNC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZPF4	0.943	0.943	0.000	1028	0.979	0.979	Q6ZPF4.pdb.gz	FMNL3_MOUSE Formin-like protein 3 OS=Mus musculus OX=10090 GN=Fmnl3 PE=1 SV=2
2	AFDB:Q6NXC0	0.723	0.711	3.297E-97	1047	0.768	0.754	Q6NXC0.pdb.gz	FMNL3_DANRE Formin-like protein 3 OS=Danio rerio OX=7955 GN=fmnl3 PE=2 SV=2
3	AFDB:Q96PY5	0.702	0.669	4.823E-88	1086	0.726	0.687	Q96PY5.pdb.gz	FMNL2_HUMAN Formin-like protein 2 OS=Homo sapiens OX=9606 GN=FMNL2 PE=1 SV=3
4	AFDB:O95466	0.426	0.399	2.378E-75	1100	0.602	0.563	O95466.pdb.gz	FMNL1_HUMAN Formin-like protein 1 OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=3
5	AFDB:Q9JL26	0.702	0.664	1.059E-73	1094	0.580	0.545	Q9JL26.pdb.gz	FMNL1_MOUSE Formin-like protein 1 OS=Mus musculus OX=10090 GN=Fmnl1 PE=1 SV=1
6	AFDB:Q9Y4D1	0.307	0.293	1.345E-36	1078	0.271	0.259	Q9Y4D1.pdb.gz	DAAM1_HUMAN Disheveled-associated activator of morphogenesis 1 OS=Homo sapiens OX=9606 GN=DAAM1 PE=1 SV=2
7	AFDB:F1RCU7	0.319	0.306	5.337E-33	1077	0.243	0.232	F1RCU7.pdb.gz
8	AFDB:O70566	0.290	0.273	3.974E-30	1098	0.239	0.224	O70566.pdb.gz	DIAP2_MOUSE Protein diaphanous homolog 2 OS=Mus musculus OX=10090 GN=Diaph2 PE=1 SV=2
9	AFDB:Q9W5A4	0.299	0.314	1.352E-29	979	0.235	0.247	Q9W5A4.pdb.gz	Q9W5A4_DROME EG:114D9.2 protein OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=2
10	AFDB:O60879	0.292	0.273	1.408E-29	1101	0.235	0.220	O60879.pdb.gz	DIAP2_HUMAN Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2 PE=1 SV=1
11	PDB:3gniA	0.100	0.241	1.188E-1	335	0.051	0.155	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
12	PDB:7nscE	0.125	0.201	2.477E-1	615	0.050	0.083	7nscE.pdb.gz
13	PDB:7wug5	0.119	0.145	3.296E-1	782	0.052	0.068	7wug5.pdb.gz
14	PDB:4r0zA	0.156	0.267	4.568E-1	557	0.039	0.072	4r0zA.pdb.gz
15	PDB:7mqaSP	0.091	0.051	4.568E-1	2485	0.054	0.023	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:6i7sG	0.079	0.088	4.759E-1	863	0.028	0.034	6i7sG.pdb.gz	The crystal structure of human microsomal triglyceride transfer protein.
17	PDB:5tbkA	0.122	0.252	5.603E-1	417	0.040	0.098	5tbkA.pdb.gz
18	PDB:4gyoB	0.073	0.158	7.456E-1	359	0.042	0.120	4gyoB.pdb.gz	Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
19	PDB:6tedQ	0.042	0.047	8.778E-1	890	0.047	0.054	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
20	PDB:7q2xD	0.085	0.087	9.525E-1	994	0.044	0.045	7q2xD.pdb.gz	Clamping of DNA shuts the condensin neck gate.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8W1F5	0.0	2103	1027	0.999	1.000	F8W1F5_HUMAN Formin like 3 OS=Homo sapiens OX=9606 GN=FMNL3 PE=1 SV=1
2	O95466	0.0	591	1100	0.289	0.270	FMNL1_HUMAN Formin-like protein 1 OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=3
3	Q6NXC0	0.0	802	1047	0.375	0.368	FMNL3_DANRE Formin-like protein 3 OS=Danio rerio OX=7955 GN=fmnl3 PE=2 SV=2
4	Q6ZN96	0.0	669	568	0.326	0.590	Q6ZN96_HUMAN cDNA FLJ16308 fis, clone PUAEN2006335 OS=Homo sapiens OX=9606 PE=1 SV=1
5	Q6ZPF4	0.0	2070	1028	0.980	0.980	FMNL3_MOUSE Formin-like protein 3 OS=Mus musculus OX=10090 GN=Fmnl3 PE=1 SV=2
6	Q8IVF7	0.0	2108	1028	1.000	1.000	FMNL3_HUMAN Formin-like protein 3 OS=Homo sapiens OX=9606 GN=FMNL3 PE=1 SV=3
7	Q96PY5	0.0	768	1086	0.351	0.332	FMNL2_HUMAN Formin-like protein 2 OS=Homo sapiens OX=9606 GN=FMNL2 PE=1 SV=3
8	Q9JL26	0.0	596	1094	0.297	0.279	FMNL1_MOUSE Formin-like protein 1 OS=Mus musculus OX=10090 GN=Fmnl1 PE=1 SV=1
9	Q9VUC6	0.0	792	1183	0.449	0.391	FRL_DROME Formin-like protein OS=Drosophila melanogaster OX=7227 GN=Frl PE=1 SV=3
10	K7EK60	2.21e-170	516	682	0.259	0.390	K7EK60_HUMAN Formin like 1 OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=1
11	K7EJE6	7.41e-144	441	488	0.227	0.477	K7EJE6_HUMAN Formin like 1 (Fragment) OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=1
12	A0A0R4IER9	7.23e-56	213	1060	0.120	0.116	A0A0R4IER9_DANRE Disheveled-associated activator of morphogenesis 1 isoform X2 OS=Danio rerio OX=7955 GN=daam1a PE=4 SV=1
13	A0A1D5P556	2.65e-55	211	1075	0.128	0.123	DAAM2_CHICK Disheveled-associated activator of morphogenesis 2 OS=Gallus gallus OX=9031 GN=DAAM2 PE=1 SV=2
14	Q86T65	4.77e-55	210	1068	0.127	0.123	DAAM2_HUMAN Disheveled-associated activator of morphogenesis 2 OS=Homo sapiens OX=9606 GN=DAAM2 PE=1 SV=3
15	Q8BPM0	8.59e-55	209	1077	0.121	0.115	DAAM1_MOUSE Disheveled-associated activator of morphogenesis 1 OS=Mus musculus OX=10090 GN=Daam1 PE=1 SV=4
16	Q9Y4D1	2.26e-54	208	1078	0.126	0.121	DAAM1_HUMAN Disheveled-associated activator of morphogenesis 1 OS=Homo sapiens OX=9606 GN=DAAM1 PE=1 SV=2
17	B3DJI0	1.54e-53	206	1069	0.133	0.128	B3DJI0_DANRE Daam1l protein OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
18	Q5RHJ3	2.71e-53	205	1079	0.132	0.126	Q5RHJ3_DANRE Disheveled-associated activator of morphogenesis 1 OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
19	Q8IRY0	1.35e-49	194	1153	0.118	0.105	Q8IRY0_DROME Dishevelled associated activator of morphogenesis, isoform B OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
20	Q7YZA4	1.41e-49	193	1114	0.118	0.109	Q7YZA4_DROME Dishevelled associated activator of morphogenesis, isoform A OS=Drosophila melanogaster OX=7227 GN=DAAM PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06148 COG2	42	15.7	COG (conserved oligomeric Golgi) complex component, COG2
2	PF06367 Drf_FH3	8.9e-48	174.0	Diaphanous FH3 Domain
3	PF06371 Drf_GBD	1.5e-22	91.6	Diaphanous GTPase-binding Domain
4	PF02181 FH2	1e-99	345.8	Formin Homology 2 Domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008949425.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008961300.1	0.862	Ras homolog family member C
2	9597.XP_003804292.1	0.772	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 754 ESTs, 35 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
3	9597.XP_003814005.1	0.772	Cell division control protein 42 homolog isoform X1
4	9597.XP_003818417.1	0.772	Ras homolog family member A
5	9597.XP_008971161.1	0.772	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
6	9597.XP_008968944.1	0.675	Rho guanine nucleotide exchange factor 16
7	9597.XP_008960787.1	0.660	Belongs to the profilin family.
8	9597.XP_008968278.1	0.645	Rho guanine nucleotide exchange factor 9 isoform X1
9	9597.XP_003845959.1	0.609	Formin 1
10	9597.XP_003827060.1	0.594	Ras homolog family member B
11	9597.XP_003825372.1	0.581	Diaphanous related formin 3
12	9597.XP_003815945.1	0.574	FH2 domain containing 1
13	9597.XP_008952951.1	0.559	Diaphanous related formin 1
14	9597.XP_003831672.1	0.548	Ras homolog family member J
15	9597.XP_003831700.1	0.548	Disheveled-associated activator of morphogenesis 1 isoform X1
16	9597.XP_003821605.1	0.547	Ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
17	9597.XP_003831144.2	0.547	Ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
18	9597.XP_008956668.1	0.547	Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
19	9597.XP_008962197.1	0.547	Ras-related C3 botulinum toxin substrate 1
20	9597.XP_008962977.1	0.547	Uncharacterized protein LOC100985182

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0032794	0.647	GTPase activating protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.989	regulation of biological process
GO:0016043	0.976	cellular component organization
GO:0030030	0.972	cell projection organization
GO:0048870	0.971	cell motility
GO:0008360	0.967	regulation of cell shape
GO:0030036	0.965	actin cytoskeleton organization
GO:0022607	0.940	cellular component assembly
GO:0030031	0.918	cell projection assembly
GO:0050794	0.735	regulation of cellular process
GO:0120036	0.636	plasma membrane bounded cell projection organization
GO:0016477	0.513	cell migration
GO:0120031	0.461	plasma membrane bounded cell projection assembly
GO:0032502	0.410	developmental process
GO:0050896	0.402	response to stimulus
GO:0046847	0.393	filopodium assembly
GO:0048856	0.391	anatomical structure development
GO:0007015	0.363	actin filament organization
GO:0051716	0.343	cellular response to stimulus
GO:0032501	0.322	multicellular organismal process
GO:0031532	0.308	actin cytoskeleton reorganization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005886	0.998	plasma membrane
GO:0012505	0.996	endomembrane system
GO:0031982	0.894	vesicle
GO:0005794	0.880	Golgi apparatus
GO:0043232	0.392	intracellular non-membrane-bounded organelle
GO:0005634	0.319	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]