StarFunc result for job id Q8IVG5

User Input

>input (1584 residues)
MSKQVSLPEMIKDWTKEHVKKWVNEDLKINEQYGQILLSEEVTGLVLQELTEKDLVEMGL
PWGPALLIKRSYNKLNSKSPESDNHDPGQLDNSKPSKTEHQKNPKHTKKEEENSMSSNID
YDPREIRDIKQEESILMKENVLDEVANAKHKKKGKLKPEQLTCMPYPFDQFHDSHRYIEH
YTLQPETGALNLIDPIHEFKALTNTETATEVDIKMKFSNEVFRFASACMNSRTNGTIHFG
VKDKPHGEIVGVKITSKAAFIDHFNVMIKKYFEESEINEAKKCIREPRFVEVLLQNNTPS
DRFVIEVDTIPKHSICNDKYFYIQMQICKDKIWKQNQNLSLFVREGASSRDILANSKQRD
VDFKAFLQNLKSLVASRKEAEEEYGMKAMKKESEGLKLVKLLIGNRDSLDNSYYDWYILV
TNKCHPNQIKHLDFLKEIKWFAVLEFDPESMINGVVKAYKESRVANLHFPNQYEDKTTNM
WEKISTLNLYQQPSWIFCNGRSDLKSETYKPLEPHLWQRERASEVRKLILFLTDENIMTR
GKFLVVFLLLSSVESPGDPLIETFWAFYQALKGMENMLCISVNSHIYQRWKDLLQTRMKM
EDELTNHSISTLNIELVNSTILKLKSVTRSSRRFLPARGSSSVILEKKKEDVLTALEILC
ENECTETDIEKDKSKFLEFKKSKEEHFYRGGKVSWWNFYFSSENYSSDFVKRDSYEKLKD
LIHCWAESPKPIFAKIINLYHHPGCGGTTLAMHVLWDLKKNFRCAVLKNKTTDFAEIAEQ
VINLVTYRAKSHQDYIPVLLLVDDFEEQENVYFLQNAIHSVLAEKDLRYEKTLVIILNCM
RSRNPDESAKLADSIALNYQLSSKEQRAFGAKLKEIEKQHKNCENFYSFMIMKSNFDETY
IENVVRNILKGQDVDSKEAQLISFLALLSSYVTDSTISVSQCEIFLGIIYTSTPWEPESL
EDKMGTYSTLLIKTEVAEYGRYTGVRIIHPLIALYCLKELERSYHLDKCQIALNILEENL
FYDSGIGRDKFQHDVQTLLLTRQRKVYGDETDTLFSPLMEALQNKDIEKVLSAGSRRFPQ
NAFICQALARHFYIKEKDFNTALDWARQAKMKAPKNSYISDTLGQVYKSEIKWWLDGNKN
CRSITVNDLTHLLEAAEKASRAFKESQRQTDSKNYETENWSPQKSQRRYDMYNTACFLGE
IEVGLYTIQILQLTPFFHKENELSKKHMVQFLSGKWTIPPDPRNECYLALSKFTSHLKNL
QSDLKRCFDFFIDYMVLLKMRYTQKEIAEIMLSKKVSRCFRKYTELFCHLDPCLLQSKES
QLLQEENCRKKLEALRADRFAGLLEYLNPNYKDATTMESIVNEYAFLLQQNSKKPMTNEK
QNSILANIILSCLKPNSKLIQPLTTLKKQLREVLQFVGLSHQYPGPYFLACLLFWPENQE
LDQDSKLIEKYVSSLNRSFRGQYKRMCRSKQASTLFYLGKRKGLNSIVHKAKIEQYFDKA
QNTNSLWHSGDVWKKNEVKDLLRRLTGQAEGKLISVEYGTEEKIKIPVISVYSGPLRSGR
NIERVSFYLGFSIEGPLAYDIEVI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5K651	0.881	0.878	0.000	1589	0.604	0.602	Q5K651.pdb.gz	SAMD9_HUMAN Sterile alpha motif domain-containing protein 9 OS=Homo sapiens OX=9606 GN=SAMD9 PE=1 SV=1
2	AFDB:Q69Z37	0.862	0.875	0.000	1561	0.715	0.726	Q69Z37.pdb.gz	SAM9L_MOUSE Sterile alpha motif domain-containing protein 9-like OS=Mus musculus OX=10090 GN=Samd9l PE=1 SV=2
3	AFDB:Q8IVG5	1.000	1.000	0.000	1584	1.000	1.000	Q8IVG5.pdb.gz	SAM9L_HUMAN Sterile alpha motif domain-containing protein 9-like OS=Homo sapiens OX=9606 GN=SAMD9L PE=1 SV=2
4	PDB:7oikA	0.087	0.044	2.107E-5	4426	0.090	0.032	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
5	PDB:2qbyA	0.104	0.350	1.093E-4	366	0.027	0.115	2qbyA.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
6	PDB:7dkhI	0.088	0.141	1.996E-4	914	0.054	0.093	7dkhI.pdb.gz
7	PDB:7qdrB	0.079	0.099	2.540E-4	1212	0.054	0.071	7qdrB.pdb.gz
8	PDB:4bujB	0.085	0.096	4.638E-4	1367	0.070	0.081	4bujB.pdb.gz
9	AFDB:P89105	0.077	0.097	4.829E-4	1077	0.074	0.109	P89105.pdb.gz	CTR9_YEAST RNA polymerase-associated protein CTR9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTR9 PE=1 SV=3
10	PDB:6j5wA	0.118	0.208	6.930E-4	816	0.032	0.062	6j5wA.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.
11	PDB:5vqaA	0.104	0.337	1.078E-3	368	0.028	0.120	5vqaA.pdb.gz	The AAA+ ATPase TRIP13 remodels HORMA domains through N-terminal engagement and unfolding.
12	AFDB:Q9QUK4	0.091	0.096	1.122E-3	1447	0.078	0.085	Q9QUK4.pdb.gz	BIR1B_MOUSE Baculoviral IAP repeat-containing protein 1b OS=Mus musculus OX=10090 GN=Naip2 PE=1 SV=2
13	AFDB:Q86W26	0.112	0.227	1.969E-3	655	0.036	0.087	Q86W26.pdb.gz	NAL10_HUMAN NACHT, LRR and PYD domains-containing protein 10 OS=Homo sapiens OX=9606 GN=NLRP10 PE=1 SV=1
14	PDB:2qbyB	0.102	0.317	2.133E-3	368	0.025	0.106	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
15	PDB:7ntfA	0.075	0.108	2.311E-3	918	0.032	0.054	7ntfA.pdb.gz
16	PDB:4horA	0.070	0.173	3.453E-3	482	0.049	0.160	4horA.pdb.gz	Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
17	AFDB:Q583S9	0.067	0.081	1.466E-2	1251	0.070	0.089	Q583S9.pdb.gz	Q583S9_TRYB2 ATP-dependent DEAH-box RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3D8.660 PE=4 SV=1
18	AFDB:Q9YHB5	0.101	0.133	1.466E-2	1034	0.053	0.081	Q9YHB5.pdb.gz	CND3_XENLA Condensin complex subunit 3 OS=Xenopus laevis OX=8355 GN=ncapg PE=1 SV=1
19	AFDB:O60293	0.065	0.055	1.653E-2	1989	0.045	0.036	O60293.pdb.gz	ZC3H1_HUMAN Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1 PE=1 SV=3
20	AFDB:A0A1D8PRW9	0.046	0.060	2.900E-2	1172	0.023	0.032	A0A1D8PRW9.pdb.gz	A0A1D8PRW9_CANAL Boi2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BOI2 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JKF1	0.0	1544	1283	0.503	0.621	C9JKF1_HUMAN Sterile alpha motif domain containing 9 (Fragment) OS=Homo sapiens OX=9606 GN=SAMD9 PE=1 SV=1
2	Q5K651	0.0	1868	1589	0.609	0.607	SAMD9_HUMAN Sterile alpha motif domain-containing protein 9 OS=Homo sapiens OX=9606 GN=SAMD9 PE=1 SV=1
3	Q69Z37	0.0	2297	1561	0.717	0.727	SAM9L_MOUSE Sterile alpha motif domain-containing protein 9-like OS=Mus musculus OX=10090 GN=Samd9l PE=1 SV=2
4	Q8IVG5	0.0	3289	1584	1.000	1.000	SAM9L_HUMAN Sterile alpha motif domain-containing protein 9-like OS=Homo sapiens OX=9606 GN=SAMD9L PE=1 SV=2
5	P24004	1.1	36.6	1043	0.018	0.027	PEX1_YEAST Peroxisomal ATPase PEX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEX1 PE=1 SV=2
6	A0A1D8PR43	3.2	35.0	1090	0.016	0.023	A0A1D8PR43_CANAL Peroxisomal ATPase PEX1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PEX1 PE=4 SV=1
7	O23813	3.4	34.7	635	0.013	0.031	SIR_MAIZE Sulfite reductase [ferredoxin], chloroplastic OS=Zea mays OX=4577 GN=SIR PE=1 SV=1
8	P39769	3.8	34.7	1589	0.016	0.016	PHP_DROME Polyhomeotic-proximal chromatin protein OS=Drosophila melanogaster OX=7227 GN=ph-p PE=1 SV=2
9	Q8ML92	4.3	32.0	106	0.010	0.151	AVE_DROME Protein aveugle OS=Drosophila melanogaster OX=7227 GN=ave PE=1 SV=1
10	Q9VHA0	4.7	34.3	877	0.013	0.024	SCM_DROME Polycomb protein Scm OS=Drosophila melanogaster OX=7227 GN=Scm PE=1 SV=2
11	D3YXJ0	5.6	34.3	1211	0.011	0.015	DGKH_MOUSE Diacylglycerol kinase eta OS=Mus musculus OX=10090 GN=Dgkh PE=1 SV=2
12	Q86XP1	6.7	33.9	1220	0.014	0.018	DGKH_HUMAN Diacylglycerol kinase eta OS=Homo sapiens OX=9606 GN=DGKH PE=1 SV=1
13	O75417	7.6	33.9	2590	0.013	0.008	DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens OX=9606 GN=POLQ PE=1 SV=2
14	Q96NU1	8.5	33.5	681	0.014	0.032	SAM11_HUMAN Sterile alpha motif domain-containing protein 11 OS=Homo sapiens OX=9606 GN=SAMD11 PE=1 SV=3
15	Q95Y15	8.6	33.5	1340	0.024	0.028	Q95Y15_CAEEL Nucleoporin_N domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=npp-8 PE=1 SV=5
16	Q5JR95	8.8	32.3	188	0.014	0.117	Q5JR95_HUMAN Small ribosomal subunit protein eS8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=1
17	Q2Z0T5	9.6	33.1	558	0.011	0.032	Q2Z0T5_9CAUD Putative GroEL-like chaperonine protein OS=Pseudomonas phage EL OX=273133 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	93	14.9	ATPase family associated with various cellular activities (AAA)
2	PF00536 SAM_1	6.1	18.7	SAM domain (Sterile alpha motif)
3	PF07647 SAM_2	6.9	18.2	SAM domain (Sterile alpha motif)
4	PF09235 SAM_Ste50p	1.4e+02	14.2	Ste50p, sterile alpha motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326247

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360883	0.888	Interferon-induced protein with tetratricopeptide repeats 3
2	9606.ENSP00000359787	0.883	Interferon-induced protein 44-like
3	9606.ENSP00000359783	0.876	Interferon-induced protein 44
4	9606.ENSP00000259030	0.859	Receptor-transporting protein 4
5	9606.ENSP00000377344	0.855	Probable ATP-dependent RNA helicase DDX60
6	9606.ENSP00000354822	0.853	XIAP-associated factor 1
7	9606.ENSP00000371471	0.848	Radical S-adenosyl methionine domain-containing protein 2
8	9606.ENSP00000360869	0.847	Interferon-induced protein with tetratricopeptide repeats 1
9	9606.ENSP00000360891	0.847	Interferon-induced protein with tetratricopeptide repeats 2
10	9606.ENSP00000342278	0.845	2'-5'-oligoadenylate synthase 2
11	9606.ENSP00000359504	0.843	Guanylate-binding protein 1
12	9606.ENSP00000263642	0.835	Interferon-induced helicase C domain-containing protein 1
13	9606.ENSP00000354394	0.831	Signal transducer and activator of transcription 1-alpha/beta
14	9606.ENSP00000390204	0.819	HEPACAM family member 2
15	9606.ENSP00000251642	0.812	Probable ATP-dependent RNA helicase DHX58
16	9606.ENSP00000381601	0.811	Interferon-induced GTP-binding protein Mx1
17	9606.ENSP00000369299	0.809	E3 ubiquitin-protein ligase TRIM22
18	9606.ENSP00000369213	0.808	Probable ATP-dependent RNA helicase DDX58
19	9606.ENSP00000369292	0.800	Sterile alpha motif domain-containing protein 9
20	9606.ENSP00000333657	0.797	Interferon-induced GTP-binding protein Mx2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.897	biological regulation
GO:0050789	0.873	regulation of biological process
GO:0051179	0.757	localization
GO:0006906	0.682	vesicle fusion
GO:0019222	0.466	regulation of metabolic process
GO:0050794	0.425	regulation of cellular process
GO:0060255	0.422	regulation of macromolecule metabolic process
GO:0002376	0.347	immune system process
GO:0050896	0.314	response to stimulus
GO:0080090	0.312	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.994	cytosol
GO:0005739	0.765	mitochondrion
GO:0005634	0.548	nucleus
GO:0070013	0.512	intracellular organelle lumen
GO:0012505	0.402	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]