StarFunc result for job id Q8IVL0

User Input

>input (2385 residues)
MPVLGVASKLRQPAVGSKPVHTALPIPNLGTTGSQHCSSRPLELTETESSMLSCQLALKS
TCEFGEKKPLQGKAKEKEDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLAEIIQII
ANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLS
RYKQQQHHQQQYYQSLVELQQRVTHASPPSEASQAKTQQDMQSSLAARYATQSNHSGIAT
SQKKPTRLPGPSRVPAAGSSSKVQGASNLNRRSQSFNSIDKNKPPNYANGNEKDSSKGPQ
SSSGVNGNVQPPSTAGQPPASAIPSPSASKPWRSKSMNVKHSATSTMLTVKQSSTATSPT
PSSDRLKPPVSEGVKTAPSGQKSMLEKFKLVNARTALRPPQPPSSGPSDGGKDDDAFSES
GEMEGFNSGLNSGGSTNSSPKVSPKLAPPKAGSKNLSNKKSLLQPKEKEEKNRDKNKVCT
EKPVKEEKDQVTEMAPKKTSKIASLIPKGSKTTAAKKESLIPSSSGIPKPGSKVPTVKQT
ISPGSTASKESEKFRTTKGSPSQSLSKPITMEKASASSCPAPLEGREAGQASPSGSCTMT
VAQSSGQSTGNGAVQLPQQQQHSHPNTATVAPFIYRAHSENEGTALPSADSCTSPTKMDL
SYSKTAKQCLEEISGEDPETRRMRTVKNIADLRQNLEETMSSLRGTQISHSTLETTFDST
VTTEVNGRTIPNLTSRPTPMTWRLGQACPRLQAGDAPSLGAGYPRSGTSRFIHTDPSRFM
YTTPLRRAAVSRLGNMSQIDMSEKASSDLDMSSEVDVGGYMSDGDILGKSLRTDDINSGY
MTDGGLNLYTRSLNRIPDTATSRDIIQRGVHDVTVDADSWDDSSSVSSGLSDTLDNISTD
DLNTTSSVSSYSNITVPSRKNTQLRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGK
WKTVSSGLPEDPEKAGQKASLSVSQTGSWRRGMSAQGGAPSRQKAGTSALKTPGKTDDAK
ASEKGKAPLKGSSLQRSPSDAGKSSGDEGKKPPSGIGRSTATSSFGFKKPSGVGSSAMIT
SSGATITSGSATLGKIPKSAAIGGKSNAGRKTSLDGSQNQDDVVLHVSSKTTLQYRSLPR
PSKSSTSGIPGRGGHRSSTSSIDSNVSSKSAGATTSKLREPTKIGSGRSSPVTVNQTDKE
KEKVAVSDSESVSLSGSPKSSPTSASACGAQGLRQPGSKYPDIASPTFRRLFGAKAGGKS
ASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSDLTT
DVISLSHSLASSPASVHSFTSGGLVWAANMSSSSAGSKDTPSYQSMTSLHTSSESIDLPL
SHHGSLSGLTTGTHEVQSLLMRTGSVRSTLSESMQLDRNTLPKKGLRYTPSSRQANQEEG
KEWLRSHSTGGLQDTGNQSPLVSPSAMSSSAAGKYHFSNLVSPTNLSQFNLPGPSMMRSN
SIPAQDSSFDLYDDSQLCGSATSLEERPRAISHSGSFRDSMEEVHGSSLSLVSSTSSLYS
TAEEKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTMTA
EQKESELIELRETIEMLKAQNSAAQAAIQGALNGPDHPPKDLRIRRQHSSESVSSINSAT
SHSSIGSGNDADSKKKKKKNWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSL
PASPKLPHNAGDCGSASMKPSQSASASPLVWPPKKRQNGPVIYKHRSRICECTEAEAEII
LQLKSELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTA
KPTRPPSESSSSTSSSSSRQSLGLSLNNLNITEAVSSDILLDDAGDATGHKDGRSVKIIV
SISKGYGRAKDQKSQAYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRIDTSTSLGLSSDC
IASYCIGDLIRSHNLEVPELLPCGYLVGDNNIITVNLKGVEENSLDSFVFDTLIPKPITQ
RYFNLLMEHHRIILSGPSGTGKTYLANKLAEYVITKSGRKKTEDAIATFNVDHKSSKELQ
QYLANLAEQCSADNNGVELPVVIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGV
SSSPNLELHHNFRWVLCANHTEPVKGFLGRYLRRKLIEIEIERNIRNNDLVKIIDWIPKT
WHHLNSFLETHSSSDVTIGPRLFLPCPMDVEGSRVWFMDLWNYSLVPYILEAVREGLQMY
GKRTPWEDPSKWVLDTYPWSSATLPQESPALLQLRPEDVGYESCTSTKEATTSKHIPQTD
TEGDPLMNMLMKLQEAANYSSTQSCDSESTSHHEDILDSSLESTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q842	0.262	0.257	0.000	2432	0.568	0.557	E9Q842.pdb.gz	E9Q842_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
2	AFDB:F1LR12	0.245	0.242	0.000	2425	0.568	0.558	F1LR12.pdb.gz	F1LR12_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=3
3	AFDB:Q5TZ18	0.228	0.237	0.000	2269	0.624	0.656	Q5TZ18.pdb.gz	NAV3_DANRE Neuron navigator 3 OS=Danio rerio OX=7955 GN=nav3 PE=1 SV=1
4	AFDB:Q80TN7	0.346	0.349	0.000	2359	0.928	0.939	Q80TN7.pdb.gz	NAV3_MOUSE Neuron navigator 3 OS=Mus musculus OX=10090 GN=Nav3 PE=1 SV=2
5	AFDB:Q8IVL0	1.000	1.000	0.000	2385	1.000	1.000	Q8IVL0.pdb.gz	NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3 PE=1 SV=3
6	AFDB:Q8IVL1	0.230	0.222	0.000	2488	0.574	0.550	Q8IVL1.pdb.gz	NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3
7	AFDB:Q8NEY1	0.178	0.223	2.631E-87	1877	0.333	0.424	Q8NEY1.pdb.gz	NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2
8	AFDB:Q9VIQ9	0.177	0.190	9.079E-79	2197	0.277	0.300	Q9VIQ9.pdb.gz	SICK_DROME Protein sickie OS=Drosophila melanogaster OX=7227 GN=sick PE=3 SV=3
9	PDB:6ut6D	0.086	0.551	4.928E-6	292	0.022	0.178	6ut6D.pdb.gz	Structural asymmetry governs the assembly and GTPase activity of McrBC restriction complexes
10	PDB:4xguB	0.078	0.384	2.736E-5	382	0.027	0.170	4xguB.pdb.gz	TRIP13 is a protein-remodeling AAA+ ATPase that catalyzes MAD2 conformation switching.
11	PDB:5vqaA	0.077	0.349	3.389E-5	368	0.022	0.144	5vqaA.pdb.gz	The AAA+ ATPase TRIP13 remodels HORMA domains through N-terminal engagement and unfolding.
12	PDB:8dqxC	0.071	0.398	5.203E-5	330	0.015	0.106	8dqxC.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
13	PDB:7tfhB	0.075	0.432	6.446E-5	320	0.020	0.150	7tfhB.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
14	PDB:6vvoB	0.070	0.402	6.801E-5	316	0.016	0.123	6vvoB.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
15	PDB:2qbyA	0.056	0.254	1.440E-4	366	0.013	0.087	2qbyA.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
16	PDB:4w8fB	0.077	0.071	1.985E-4	2609	0.023	0.021	4w8fB.pdb.gz	Allosteric communication in the Dynein motor domain.
17	PDB:7pxcD	0.059	0.240	2.095E-4	457	0.013	0.070	7pxcD.pdb.gz	Structural basis of prokaryotic ubiquitin-like protein engagement and translocation by the mycobacterial Mpa-proteasome complex.
18	PDB:2qbyB	0.056	0.233	2.210E-4	368	0.017	0.109	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
19	AFDB:Q8C5W0	0.050	0.108	2.394E-4	1052	0.064	0.144	Q8C5W0.pdb.gz	CLMN_MOUSE Calmin OS=Mus musculus OX=10090 GN=Clmn PE=1 SV=2
20	AFDB:Q9H4A3	0.027	0.027	5.952E-4	2382	0.127	0.127	Q9H4A3.pdb.gz	WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K833	0.0	2210	2356	0.560	0.567	A0A0G2K833_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=2
2	A0A8I5ZQM9	0.0	2213	2366	0.563	0.567	A0A8I5ZQM9_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=1
3	A0A8I6A8E6	0.0	2192	2319	0.555	0.571	A0A8I6A8E6_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=1
4	E9PNV5	0.0	611	815	0.185	0.542	E9PNV5_HUMAN Neuron navigator 2 (Fragment) OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=8
5	E9Q842	0.0	2222	2432	0.574	0.563	E9Q842_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
6	F1LR12	0.0	2129	2392	0.552	0.550	F1LR12_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=3
7	Q5TZ18	0.0	2403	2269	0.621	0.653	NAV3_DANRE Neuron navigator 3 OS=Danio rerio OX=7955 GN=nav3 PE=1 SV=1
8	Q80TN7	0.0	4289	2359	0.929	0.939	NAV3_MOUSE Neuron navigator 3 OS=Mus musculus OX=10090 GN=Nav3 PE=1 SV=2
9	Q8CH77	0.0	1143	1875	0.319	0.406	NAV1_MOUSE Neuron navigator 1 OS=Mus musculus OX=10090 GN=Nav1 PE=1 SV=2
10	Q8IVL0	0.0	4875	2385	1.000	1.000	NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3 PE=1 SV=3
11	Q8IVL1	0.0	2234	2488	0.576	0.552	NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3
12	Q8NEY1	0.0	1137	1877	0.320	0.407	NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2
13	V9GX91	0.0	2225	2432	0.575	0.564	V9GX91_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
14	V9GXT3	0.0	2204	2371	0.565	0.568	V9GXT3_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
15	Q6ZPE7	2.48e-178	571	858	0.166	0.460	Q6ZPE7_MOUSE MKIAA3015 protein (Fragment) OS=Mus musculus OX=10090 GN=Nav2 PE=2 SV=1
16	Q9VIQ9	5.53e-143	500	2197	0.096	0.104	SICK_DROME Protein sickie OS=Drosophila melanogaster OX=7227 GN=sick PE=3 SV=3
17	Q8BJG0	2.72e-88	298	440	0.087	0.470	Q8BJG0_MOUSE Calponin-homology (CH) domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Nav2 PE=2 SV=1
18	B2RWS4	5.79e-80	278	576	0.104	0.429	B2RWS4_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=2 SV=1
19	Q8BYE8	7.49e-80	278	576	0.104	0.431	Q8BYE8_MOUSE Calponin-homology (CH) domain-containing protein OS=Mus musculus OX=10090 GN=Nav2 PE=2 SV=1
20	Q8BYJ2	3.68e-62	217	301	0.047	0.375	Q8BYJ2_MOUSE Calponin-homology (CH) domain-containing protein OS=Mus musculus OX=10090 GN=Nav2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	0.1	24.5	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	0.019	26.4	AAA domain
3	PF13191 AAA_16	2.2	20.1	AAA ATPase domain
4	PF13238 AAA_18	4.9	19.2	AAA domain
5	PF13245 AAA_19	51	15.5	AAA domain
6	PF07724 AAA_2	73	14.9	AAA domain (Cdc48 subfamily)
7	PF13401 AAA_22	5.5	18.7	AAA domain
8	PF13479 AAA_24	2.6e+02	12.7	AAA domain
9	PF13481 AAA_25	32	15.5	AAA domain
10	PF13521 AAA_28	76	15.0	AAA domain
11	PF07728 AAA_5	2.8e+02	12.9	AAA domain (dynein-related subfamily)
12	PF12775 AAA_7	2.3e+02	12.7	P-loop containing dynein motor region
13	PF11971 CAMSAP_CH	1.7	19.8	CAMSAP CH domain
14	PF00307 CH	2.5e-11	55.1	Calponin homology (CH) domain
15	PF06294 CH_2	94	14.5	CH-like domain in sperm protein
16	PF01695 IstB_IS21	99	13.8	IstB-like ATP binding protein
17	PF01078 Mg_chelatase	63	14.4	Magnesium chelatase, subunit ChlI
18	PF05729 NACHT	3.1e+02	12.7	NACHT domain
19	PF03266 NTPase_1	4.6e+02	12.1	NTPase
20	PF02562 PhoH	16	16.4	PhoH-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381007

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252456	0.700	Calponin-1
2	9606.ENSP00000308897	0.694	Mitochondrial ribosomal protein L11
3	9606.ENSP00000262215	0.678	Brefeldin A-inhibited guanine nucleotide-exchange protein 1
4	9606.ENSP00000356899	0.671	Discoidin domain-containing receptor 2
5	9606.ENSP00000463325	0.669	Receptor-type tyrosine-protein phosphatase mu
6	9606.ENSP00000323246	0.662	Transcription factor E2F7
7	9606.ENSP00000328088	0.660	PRKC apoptosis WT1 regulator protein
8	9606.ENSP00000261205	0.657	Synaptotagmin-1
9	9606.ENSP00000405620	0.599	Putative ATP-dependent RNA helicase DHX30
10	9606.ENSP00000298912	0.568	Calmin
11	9606.ENSP00000361824	0.548	Spectrin alpha chain, non-erythrocytic 1
12	9606.ENSP00000482885	0.543	Phosphatidylinositol phosphatase PTPRQ
13	9606.ENSP00000283228	0.520	Receptor-type tyrosine-protein phosphatase R
14	9606.ENSP00000365312	0.506	Abl interactor 1
15	9606.ENSP00000401145	0.502	Growth arrest-specific protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	0.997	microtubule binding
GO:0097367	0.308	carbohydrate derivative binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.990	biological regulation
GO:0050789	0.926	regulation of biological process
GO:0050794	0.909	regulation of cellular process
GO:0048523	0.662	negative regulation of cellular process
GO:0048518	0.588	positive regulation of biological process
GO:0048522	0.443	positive regulation of cellular process
GO:0032502	0.435	developmental process
GO:0048856	0.432	anatomical structure development
GO:0048731	0.416	system development
GO:0009987	0.415	cellular process
GO:0060255	0.415	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005634	0.990	nucleus
GO:0012505	0.985	endomembrane system
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0005737	0.943	cytoplasm
GO:0016020	0.884	membrane
GO:0005856	0.851	cytoskeleton
GO:0071944	0.772	cell periphery
GO:0099512	0.537	supramolecular fiber
GO:0070013	0.504	intracellular organelle lumen
GO:0015630	0.500	microtubule cytoskeleton
GO:0099513	0.471	polymeric cytoskeletal fiber
GO:0005874	0.433	microtubule
GO:0031975	0.430	envelope
GO:1990752	0.415	microtubule end
GO:0031967	0.351	organelle envelope
GO:0031090	0.334	organelle membrane
GO:0031981	0.320	nuclear lumen
GO:0005829	0.311	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]