StarFunc result for job id Q8IVL1

User Input

>input (2488 residues)
MPAILVASKMKSGLPKPVHSAAPILHVPPARAGPQPCYLKLGSKVEVSKTTYPSQIPLKS
QVLQGLQEPAGEGLPLRKSGSVENGFDTQIYTDWANHYLAKSGHKRLIRDLQQDVTDGVL
LAQIIQVVANEKIEDINGCPKNRSQMIENIDACLNFLAAKGINIQGLSAEEIRNGNLKAI
LGLFFSLSRYKQQQQQPQKQHLSSPLPPAVSQVAGAPSQCQAGTPQQQVPVTPQAPCQPH
QPAPHQQSKAQAEMQSSASSKDSSQSKIIRFTLGQKKISRLPGPTARVSAAGSEAKTRGG
STTANNRRSQSFNNYDKSKPVTSPPPPPSSHEKEPLASSASSHPGMSDNAPASLESGSSS
TPTNCSTSSAIPQPGAATKPWRSKSLSVKHSATVSMLSVKPPGPEAPRPTPEAMKPAPNN
QKSMLEKLKLFNSKGGSKAGEGPGSRDTSCERLETLPSFEESEELEAASRMLTTVGPASS
SPKIALKGIAQRTFSRALTNKKSSLKGNEKEKEKQQREKDKEKSKDLAKRASVTERLDLK
EEPKEDPSGAAVPEMPKKSSKIASFIPKGGKLNSAKKEPMAPSHSGIPKPGMKSMPGKSP
SAPAPSKEGERSRSGKLSSGLPQQKPQLDGRHSSSSSSLASSEGKGPGGTTLNHSISSQT
VSGSVGTTQTTGSNTVSVQLPQPQQQYNHPNTATVAPFLYRSQTDTEGNVTAESSSTGVS
VEPSHFTKTGQPALEELTGEDPEARRLRTVKNIADLRQNLEETMSSLRGTQVTHSTLETT
FDTNVTTEMSGRSILSLTGRPTPLSWRLGQSSPRLQAGDAPSMGNGYPPRANASRFINTE
SGRYVYSAPLRRQLASRGSSVCHVDVSDKAGDEMDLEGISMDAPGYMSDGDVLSKNIRTD
DITSGYMTDGGLGLYTRRLNRLPDGMAVVRETLQRNTSLGLGDADSWDDSSSVSSGISDT
IDNLSTDDINTSSSISSYANTPASSRKNLDVQTDAEKHSQVERNSLWSGDDVKKSDGGSD
SGIKMEPGSKWRRNPSDVSDESDKSTSGKKNPVISQTGSWRRGMTAQVGITMPRTKPSAP
AGALKTPGTGKTDDAKVSEKGRLSPKASQVKRSPSDAGRSSGDESKKPLPSSSRTPTANA
NSFGFKKQSGSAAGLAMITASGVTVTSRSATLGKIPKSSALVSRSAGRKSSMDGAQNQDD
GYLALSSRTNLQYRSLPRPSKSNSRNGAGNRSSTSSIDSNISSKSAGLPVPKLREPSKTA
LGSSLPGLVNQTDKEKGISSDNESVASCNSVKVNPAAQPVSSPAQTSLQPGAKYPDVASP
TLRRLFGGKPTKQVPIATAENMKNSVVISNPHATMTQQGNLDSPSGSGVLSSGSSSPLYS
KNVDLNQSPLASSPSSAHSAPSNSLTWGTNASSSSAVSKDGLGFQSVSSLHTSCESIDIS
LSSGGVPSHNSSTGLIASSKDDSLTPFVRTNSVKTTLSESPLSSPAASPKFCRSTLPRKQ
DSDPHLDRNTLPKKGLRYTPTSQLRTQEDAKEWLRSHSAGGLQDTAANSPFSSGSSVTSP
SGTRFNFSQLASPTTVTQMSLSNPTMLRTHSLSNADGQYDPYTDSRFRNSSMSLDEKSRT
MSRSGSFRDGFEEESWEKSSVDNFVSRLHSSLHFSLPLFHHARYELVHGSSLSLVSSTSS
VYSTPEEKCQSEIRKLRRELDASQEKVSALTTQLTANAHLVAAFEQSLGNMTIRLQSLTM
TAEQKDSELNELRKTIELLKKQNAAAQAAINGVINTPELNCKGNGTAQSADLRIRRQHSS
DSVSSINSATSHSSVGSNIESDSKKKKRKNWVNELRSSFKQAFGKKKSPKSASSHSDIEE
MTDSSLPSSPKLPHNGSTGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEMKLTD
IRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVSISASPRQ
SMGLSQHSLNLTESTSLDMLLDDTGECSARKEGGRHVKIVVSFQEEMKWKEDSRPHLFLI
GCIGVSGKTKWDVLDGVVRRLFKEYIIHVDPVSQLGLNSDSVLGYSIGEIKRSNTSETPE
LLPCGYLVGENTTISVTVKGLAENSLDSLVFESLIPKPILQRYVSLLIEHRRIILSGPSG
TGKTYLANRLSEYIVLREGRELTDGVIATFNVDHKSSKELRQYLSNLADQCNSENNAVDM
PLVIILDNLHHVSSLGEIFNGLLNCKYHKCPYIIGTMNQATSSTPNLQLHHNFRWVLCAN
HTEPVKGFLGRFLRRKLMETEISGRVRNMELVKIIDWIPKVWHHLNRFLEAHSSSDVTIG
PRLFLSCPIDVDGSRVWFTDLWNYSIIPYLLEAVREGLQLYGRRAPWEDPAKWVMDTYPW
AASPQQHEWPPLLQLRPEDVGFDGYSMPREGSTSKQMPPSDAEGDPLMNMLMRLQEAANY
SSPQSYDSDSNSNSHHDDILDSSLESTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q842	0.323	0.328	0.000	2432	0.908	0.929	E9Q842.pdb.gz	E9Q842_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
2	AFDB:F1LR12	0.288	0.293	0.000	2425	0.912	0.936	F1LR12.pdb.gz	F1LR12_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=3
3	AFDB:Q5TZ18	0.185	0.201	0.000	2269	0.490	0.537	Q5TZ18.pdb.gz	NAV3_DANRE Neuron navigator 3 OS=Danio rerio OX=7955 GN=nav3 PE=1 SV=1
4	AFDB:Q80TN7	0.216	0.227	0.000	2359	0.543	0.573	Q80TN7.pdb.gz	NAV3_MOUSE Neuron navigator 3 OS=Mus musculus OX=10090 GN=Nav3 PE=1 SV=2
5	AFDB:Q8IVL0	0.221	0.229	0.000	2385	0.549	0.572	Q8IVL0.pdb.gz	NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3 PE=1 SV=3
6	AFDB:Q8IVL1	1.000	1.000	0.000	2488	1.000	1.000	Q8IVL1.pdb.gz	NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3
7	AFDB:Q8NEY1	0.172	0.223	3.302E-85	1877	0.314	0.416	Q8NEY1.pdb.gz	NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2
8	AFDB:Q9VIQ9	0.161	0.181	3.669E-77	2197	0.281	0.318	Q9VIQ9.pdb.gz	SICK_DROME Protein sickie OS=Drosophila melanogaster OX=7227 GN=sick PE=3 SV=3
9	PDB:6ut6D	0.085	0.611	2.886E-6	292	0.022	0.188	6ut6D.pdb.gz	Structural asymmetry governs the assembly and GTPase activity of McrBC restriction complexes
10	AFDB:B7YZU4	0.037	0.042	2.134E-5	2044	0.103	0.126	B7YZU4.pdb.gz	B7YZU4_DROME Calmodulin-binding transcription activator, isoform F OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=1
11	AFDB:P56786	0.064	0.067	2.937E-5	2294	0.117	0.126	P56786.pdb.gz	YCF2_ARATH Protein Ycf2 OS=Arabidopsis thaliana OX=3702 GN=ycf2-A PE=3 SV=1
12	PDB:4d1eA	0.039	0.113	6.328E-5	859	0.012	0.034	4d1eA.pdb.gz
13	PDB:8dqxC	0.072	0.407	2.395E-4	330	0.015	0.115	8dqxC.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
14	PDB:7tfhB	0.068	0.400	2.963E-4	320	0.020	0.156	7tfhB.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
15	PDB:4xguB	0.066	0.357	3.125E-4	382	0.018	0.118	4xguB.pdb.gz	TRIP13 is a protein-remodeling AAA+ ATPase that catalyzes MAD2 conformation switching.
16	PDB:6vvoB	0.064	0.363	3.125E-4	316	0.016	0.127	6vvoB.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
17	PDB:7mhsE	0.061	0.249	3.125E-4	489	0.019	0.098	7mhsE.pdb.gz	Active conformation of the p97-p47 unfoldase complex.
18	PDB:5ifwB	0.060	0.176	3.476E-4	702	0.017	0.060	5ifwB.pdb.gz	Quantitative interaction mapping reveals an extended UBX domain in ASPL that disrupts functional p97 hexamers.
19	PDB:6epcJ	0.062	0.270	4.301E-4	406	0.026	0.158	6epcJ.pdb.gz	In Situ Structure of Neuronal C9orf72 Poly-GA Aggregates Reveals Proteasome Recruitment.
20	PDB:8dqwE	0.062	0.322	5.046E-4	354	0.017	0.121	8dqwE.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K833	0.0	4145	2356	0.881	0.930	A0A0G2K833_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=2
2	A0A8I5ZQM9	0.0	4152	2366	0.883	0.929	A0A8I5ZQM9_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=1
3	A0A8I6A8E6	0.0	4053	2319	0.866	0.929	A0A8I6A8E6_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=1
4	B2RWS4	0.0	796	576	0.189	0.818	B2RWS4_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=2 SV=1
5	E9PNV5	0.0	1382	815	0.319	0.973	E9PNV5_HUMAN Neuron navigator 2 (Fragment) OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=8
6	E9Q842	0.0	4217	2432	0.908	0.929	E9Q842_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
7	F1LR12	0.0	4152	2392	0.888	0.924	F1LR12_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=3
8	Q5TZ18	0.0	1834	2269	0.495	0.543	NAV3_DANRE Neuron navigator 3 OS=Danio rerio OX=7955 GN=nav3 PE=1 SV=1
9	Q6ZPE7	0.0	1304	858	0.294	0.853	Q6ZPE7_MOUSE MKIAA3015 protein (Fragment) OS=Mus musculus OX=10090 GN=Nav2 PE=2 SV=1
10	Q80TN7	0.0	2276	2359	0.557	0.587	NAV3_MOUSE Neuron navigator 3 OS=Mus musculus OX=10090 GN=Nav3 PE=1 SV=2
11	Q8BJG0	0.0	651	440	0.144	0.816	Q8BJG0_MOUSE Calponin-homology (CH) domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Nav2 PE=2 SV=1
12	Q8BYE8	0.0	793	576	0.191	0.826	Q8BYE8_MOUSE Calponin-homology (CH) domain-containing protein OS=Mus musculus OX=10090 GN=Nav2 PE=2 SV=1
13	Q8CH77	0.0	1069	1875	0.303	0.402	NAV1_MOUSE Neuron navigator 1 OS=Mus musculus OX=10090 GN=Nav1 PE=1 SV=2
14	Q8IVL0	0.0	2296	2385	0.559	0.584	NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3 PE=1 SV=3
15	Q8IVL1	0.0	5083	2488	1.000	1.000	NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3
16	Q8NEY1	0.0	1071	1877	0.301	0.399	NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2
17	V9GX91	0.0	4219	2432	0.909	0.930	V9GX91_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
18	V9GXT3	0.0	4069	2371	0.879	0.922	V9GXT3_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
19	Q9VIQ9	1.94e-151	526	2197	0.097	0.110	SICK_DROME Protein sickie OS=Drosophila melanogaster OX=7227 GN=sick PE=3 SV=3
20	Q8BYJ2	5.20e-140	441	301	0.092	0.761	Q8BYJ2_MOUSE Calponin-homology (CH) domain-containing protein OS=Mus musculus OX=10090 GN=Nav2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	4	19.3	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	0.63	21.5	AAA domain
3	PF13191 AAA_16	1.5	20.6	AAA ATPase domain
4	PF13238 AAA_18	1.9	20.5	AAA domain
5	PF13245 AAA_19	58	15.3	AAA domain
6	PF13401 AAA_22	0.057	25.1	AAA domain
7	PF13479 AAA_24	89	14.2	AAA domain
8	PF13481 AAA_25	3.8e+02	12.0	AAA domain
9	PF13521 AAA_28	1.1e+02	14.4	AAA domain
10	PF13671 AAA_33	2.5e+02	13.3	AAA domain
11	PF07728 AAA_5	1.1e+02	14.2	AAA domain (dynein-related subfamily)
12	PF11971 CAMSAP_CH	2.4	19.4	CAMSAP CH domain
13	PF00307 CH	5.7e-11	53.9	Calponin homology (CH) domain
14	PF06294 CH_2	8.6e+02	11.4	CH-like domain in sperm protein
15	PF10224 DUF2205	9.5e+02	11.3	Short coiled-coil protein
16	PF01695 IstB_IS21	2.2e+02	12.7	IstB-like ATP binding protein
17	PF02562 PhoH	67	14.4	PhoH-like protein
18	PF00910 RNA_helicase	4e+02	12.8	RNA helicase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379396

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252456	0.720	Calponin-1
2	9606.ENSP00000358799	0.681	Putative RNA-binding protein 15
3	9606.ENSP00000365312	0.650	Abl interactor 1
4	9606.ENSP00000282111	0.580	Transcription factor 7-like 1
5	9606.ENSP00000463325	0.579	Receptor-type tyrosine-protein phosphatase mu
6	9606.ENSP00000328088	0.567	PRKC apoptosis WT1 regulator protein
7	9606.ENSP00000401145	0.548	Growth arrest-specific protein 2
8	9606.ENSP00000323246	0.542	Transcription factor E2F7
9	9606.ENSP00000261205	0.532	Synaptotagmin-1
10	9606.ENSP00000382250	0.524	Mitochondrial ribosomal protein S6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008201	0.999	heparin binding
GO:0005515	0.998	protein binding
GO:0003824	0.894	catalytic activity
GO:0043138	0.739	3'-5' DNA helicase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007399	0.986	nervous system development
GO:0065007	0.912	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0071944	0.990	cell periphery
GO:0043229	0.971	intracellular organelle
GO:0043227	0.925	membrane-bounded organelle
GO:0043231	0.921	intracellular membrane-bounded organelle
GO:0005614	0.862	interstitial matrix
GO:0016020	0.839	membrane
GO:0005737	0.730	cytoplasm
GO:0005634	0.668	nucleus
GO:0031974	0.655	membrane-enclosed lumen
GO:0043233	0.527	organelle lumen
GO:0070013	0.520	intracellular organelle lumen
GO:0031981	0.500	nuclear lumen
GO:0005654	0.493	nucleoplasm
GO:0043228	0.434	non-membrane-bounded organelle
GO:0043232	0.383	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.2.4	0.739	DNA 3'-5' helicase.

[back to server]