StarFunc result for job id Q8IVN3

User Input

>input (82 residues)
MSQAGAQEAPIKKKRPPVKDEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSR
TRTGTETVFEKPKAGPTKSVFG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80XX4	0.651	0.651	1.297E-9	82	0.854	0.854	Q80XX4.pdb.gz	MSTN1_RAT Musculoskeletal embryonic nuclear protein 1 OS=Rattus norvegicus OX=10116 GN=Mustn1 PE=1 SV=1
2	AFDB:Q76MS9	0.686	0.715	1.030E-8	78	0.744	0.782	Q76MS9.pdb.gz	MSTN1_CHICK Musculoskeletal embryonic nuclear protein 1 OS=Gallus gallus OX=9031 GN=MUSTN1 PE=3 SV=1
3	AFDB:E7F422	0.647	0.712	3.066E-6	73	0.537	0.603	E7F422.pdb.gz	E7F422_DANRE Musculoskeletal embryonic nuclear protein 1 OS=Danio rerio OX=7955 GN=mustn1a PE=3 SV=2
4	PDB:7kgbm	0.242	0.185	4.268	116	0.110	0.078	7kgbm.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
5	AFDB:E9PY46	0.140	0.018	6.541	1464	0.134	0.008	E9PY46.pdb.gz	IF140_MOUSE Intraflagellar transport protein 140 homolog OS=Mus musculus OX=10090 GN=Ift140 PE=1 SV=1
6	AFDB:Q8RWV8	0.251	0.060	6.541	442	0.146	0.027	Q8RWV8.pdb.gz	U1165_ARATH U11/U12 small nuclear ribonucleoprotein 65 kDa protein OS=Arabidopsis thaliana OX=3702 GN=SNRNP65 PE=1 SV=1
7	AFDB:Q10425	0.187	0.029	7.043	725	0.183	0.021	Q10425.pdb.gz	EIF3B_SCHPO Eukaryotic translation initiation factor 3 subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC25G10.08 PE=1 SV=1
8	AFDB:Q03673	0.203	0.090	7.584	198	0.122	0.051	Q03673.pdb.gz	AIM34_YEAST Altered inheritance of mitochondria protein 34, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AIM34 PE=1 SV=1
9	PDB:6qw6X	0.138	0.185	8.305	49	0.049	0.082	6qw6X.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
10	AFDB:Q6TY21	0.171	0.073	8.793	218	0.195	0.073	Q6TY21.pdb.gz	EPA2B_XENLA Embryonic polyadenylate-binding protein 2-B OS=Xenopus laevis OX=8355 GN=Pabpn1l-b PE=1 SV=1
11	PDB:6gmlU	0.241	0.138	9.629	183	0.134	0.060	6gmlU.pdb.gz	Structure of paused transcription complex Pol II-DSIF-NELF.
12	PDB:6qdvO	0.165	0.046	9.629	441	0.280	0.052	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80XX4	3.41e-46	144	82	0.854	0.854	MSTN1_RAT Musculoskeletal embryonic nuclear protein 1 OS=Rattus norvegicus OX=10116 GN=Mustn1 PE=1 SV=1
2	Q99JI1	8.33e-45	140	82	0.841	0.841	MSTN1_MOUSE Musculoskeletal embryonic nuclear protein 1 OS=Mus musculus OX=10090 GN=Mustn1 PE=1 SV=1
3	Q76MS9	6.38e-40	128	78	0.744	0.782	MSTN1_CHICK Musculoskeletal embryonic nuclear protein 1 OS=Gallus gallus OX=9031 GN=MUSTN1 PE=3 SV=1
4	E7F422	4.21e-23	85.5	73	0.537	0.603	E7F422_DANRE Musculoskeletal embryonic nuclear protein 1 OS=Danio rerio OX=7955 GN=mustn1a PE=3 SV=2
5	Q8N0Z3	0.68	30.0	855	0.341	0.033	SPICE_HUMAN Spindle and centriole-associated protein 1 OS=Homo sapiens OX=9606 GN=SPICE1 PE=1 SV=1
6	Q9SJF3	3.0	28.1	367	0.195	0.044	DCP1_ARATH mRNA-decapping enzyme-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g08370 PE=1 SV=2
7	P38929	4.9	27.7	1173	0.183	0.013	ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMC1 PE=1 SV=1
8	Q8H104	6.9	27.3	532	0.159	0.024	SYDC1_ARATH Aspartate--tRNA ligase 1, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g26870 PE=2 SV=1
9	P40722	8.1	26.9	317	0.134	0.035	SOPD_SALTY Secreted effector protein SopD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=sopD PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15682 Mustang	6e-37	136.9	Musculoskeletal, temporally activated-embryonic nuclear protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000410910

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000411932	0.612	Leiomodin-2
2	9606.ENSP00000349459	0.597	Serine protease inhibitor Kazal-type 14
3	9606.ENSP00000252595	0.588	Long-chain fatty acid transport protein 1
4	9606.ENSP00000372459	0.571	CBP80/20-dependent translation initiation factor
5	9606.ENSP00000267973	0.521	WD repeat-containing protein 61
6	9606.ENSP00000319370	0.519	Calcium-activated potassium channel subunit beta-3
7	9606.ENSP00000263925	0.518	E3 ubiquitin-protein ligase LNX
8	9606.ENSP00000423567	0.508	Coiled-coil domain containing 153

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.963	regulation of cellular process
GO:0019222	0.862	regulation of metabolic process
GO:0009987	0.847	cellular process
GO:0048518	0.842	positive regulation of biological process
GO:0060255	0.832	regulation of macromolecule metabolic process
GO:0032501	0.830	multicellular organismal process
GO:0080090	0.829	regulation of primary metabolic process
GO:0031323	0.829	regulation of cellular metabolic process
GO:0051171	0.818	regulation of nitrogen compound metabolic process
GO:0032502	0.763	developmental process
GO:0009889	0.724	regulation of biosynthetic process
GO:0048856	0.704	anatomical structure development
GO:0051246	0.667	regulation of protein metabolic process
GO:0048522	0.649	positive regulation of cellular process
GO:0031326	0.645	regulation of cellular biosynthetic process
GO:1903018	0.644	regulation of glycoprotein metabolic process
GO:0050896	0.562	response to stimulus
GO:0010556	0.562	regulation of macromolecule biosynthetic process
GO:0061035	0.540	regulation of cartilage development
GO:0031099	0.480	regeneration
GO:0007275	0.454	multicellular organism development
GO:0048736	0.425	appendage development
GO:0010468	0.409	regulation of gene expression
GO:0051094	0.339	positive regulation of developmental process
GO:0040007	0.330	growth
GO:0048519	0.329	negative regulation of biological process
GO:0048523	0.315	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.976	intracellular organelle lumen
GO:0031981	0.945	nuclear lumen
GO:0005654	0.900	nucleoplasm
GO:0005737	0.356	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]