StarFunc result for job id Q8IVS8

User Input

>input (523 residues)
MAAALQVLPRLARAPLHPLLWRGSVARLASSMALAEQARQLFESAVGAVLPGPMLHRALS
LDPGGRQLKVRDRNFQLRQNLYLVGFGKAVLGMAAAAEELLGQHLVQGVISVPKGIRAAM
ERAGKQEMLLKPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGS
ALLPAPIPPVTLEEKQTLTRLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVVSLI
LSDVVGDPVEVIASGPTVASSHNVQDCLHILNRYGLRAALPRSVKTVLSRADSDPHGPHT
CGHVLNVIIGSNVLALAEAQRQAEALGYQAVVLSAAMQGDVKSMAQFYGLLAHVARTRLT
PSMAGASVEEDAQLHELAAELQIPDLQLEEALETMAWGRGPVCLLAGGEPTVQLQGSGRG
GRNQELALRVGAELRRWPLGPIDVLFLSGGTDGQDGPTEAAGAWVTPELASQAAAEGLDI
ATFLAHNDSHTFFCCLQGGAHLLHTGMTGTNVMDTHLLFLRPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1LQE8	0.973	0.973	6.541E-95	523	1.000	1.000	A1LQE8.pdb.gz
2	AFDB:Q0VGK3	0.963	0.963	1.856E-85	523	0.836	0.836	Q0VGK3.pdb.gz	GLCTK_RAT Glycerate kinase OS=Rattus norvegicus OX=10116 GN=Glyctk PE=1 SV=1
3	AFDB:O58231	0.769	0.909	2.570E-36	440	0.266	0.316	O58231.pdb.gz	GCK_PYRHO Glycerate 2-kinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=gck PE=1 SV=1
4	AFDB:Q9X1S1	0.735	0.916	2.903E-35	417	0.283	0.355	Q9X1S1.pdb.gz	GCK_THEMA D-glycerate 2-kinase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=TM_1585 PE=1 SV=1
5	PDB:1x3lA	0.745	0.885	3.638E-35	436	0.268	0.321	1x3lA.pdb.gz
6	PDB:2b8nA	0.733	0.918	3.898E-34	414	0.285	0.360	2b8nA.pdb.gz
7	AFDB:Q6KZ25	0.664	0.827	1.506E-30	415	0.220	0.277	Q6KZ25.pdb.gz	GCK_PICTO Glycerate 2-kinase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3) OX=1122961 GN=gck PE=1 SV=1
8	AFDB:C9J3N5	0.389	0.713	3.037E-29	283	0.398	0.735	C9J3N5.pdb.gz	C9J3N5_HUMAN CG9886-like, isoform CRA_a OS=Homo sapiens OX=9606 GN=GLYCTK PE=1 SV=1
9	AFDB:Q96YZ3	0.653	0.842	1.695E-26	399	0.218	0.286	Q96YZ3.pdb.gz	GCK_SULTO Glycerate 2-kinase OS=Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) OX=273063 GN=gck PE=1 SV=1
10	PDB:2vxyA	0.164	0.253	9.352E-3	306	0.084	0.144	2vxyA.pdb.gz
11	AFDB:O82533	0.158	0.170	1.138E-2	478	0.088	0.096	O82533.pdb.gz	FTZ21_ARATH Cell division protein FtsZ homolog 2-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSZ2-1 PE=1 SV=2
12	PDB:1y1pA	0.166	0.227	1.217E-2	342	0.086	0.132	1y1pA.pdb.gz	X-ray Structures of NADPH-dependent Carbonyl Reductase from Sporobolomyces salmonicolor Provide Insights into Stereoselective Reductions of Carbonyl Compounds
13	PDB:5zueA	0.157	0.241	1.217E-2	309	0.092	0.155	5zueA.pdb.gz	Lateral interactions between protofilaments of the bacterial tubulin homolog FtsZ are essential for cell division
14	AFDB:Q582X3	0.140	0.113	1.264E-2	781	0.096	0.064	Q582X3.pdb.gz	Q582X3_TRYB2 GPI inositol-deacylase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.210 PE=3 SV=1
15	PDB:1acoA	0.129	0.104	2.415E-2	753	0.117	0.081	1acoA.pdb.gz	Crystal structures of aconitase with trans-aconitate and nitrocitrate bound.
16	AFDB:Q556J2	0.146	0.205	4.976E-2	334	0.061	0.096	Q556J2.pdb.gz	KDSR_DICDI 3-ketodihydrosphingosine reductase OS=Dictyostelium discoideum OX=44689 GN=ksrA-1 PE=3 SV=1
17	PDB:4l5jA	0.197	0.293	5.915E-2	308	0.061	0.104	4l5jA.pdb.gz	Crystal Structures of the LsrR Proteins Complexed with Phospho-AI-2 and Two Signal-Interrupting Analogues Reveal Distinct Mechanisms for Ligand Recognition.
18	PDB:6jqmA	0.114	0.095	6.236E-2	678	0.096	0.074	6jqmA.pdb.gz	Molecular basis for metabolite channeling in a ring opening enzyme of the phenylacetate degradation pathway.
19	PDB:7o6pD	0.180	0.299	6.236E-2	257	0.057	0.117	7o6pD.pdb.gz
20	PDB:1nupA	0.158	0.296	6.573E-2	213	0.059	0.146	1nupA.pdb.gz	STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0VGK3	0.0	868	523	0.836	0.836	GLCTK_RAT Glycerate kinase OS=Rattus norvegicus OX=10116 GN=Glyctk PE=1 SV=1
2	Q8IVS8	0.0	1039	523	1.000	1.000	GLCTK_HUMAN Glycerate kinase OS=Homo sapiens OX=9606 GN=GLYCTK PE=1 SV=1
3	Q8QZY2	0.0	858	523	0.845	0.845	GLCTK_MOUSE Glycerate kinase OS=Mus musculus OX=10090 GN=Glyctk PE=1 SV=1
4	C9J3N5	6.58e-146	422	283	0.424	0.784	C9J3N5_HUMAN CG9886-like, isoform CRA_a OS=Homo sapiens OX=9606 GN=GLYCTK PE=1 SV=1
5	C9JA32	8.29e-144	415	240	0.405	0.883	C9JA32_HUMAN CG9886-like, isoform CRA_f OS=Homo sapiens OX=9606 GN=GLYCTK PE=1 SV=1
6	Q9X1S1	1.17e-61	210	417	0.285	0.357	GCK_THEMA D-glycerate 2-kinase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=TM_1585 PE=1 SV=1
7	O58231	5.83e-50	179	440	0.285	0.339	GCK_PYRHO Glycerate 2-kinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=gck PE=1 SV=1
8	Q6KZ25	5.08e-38	146	415	0.228	0.287	GCK_PICTO Glycerate 2-kinase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3) OX=1122961 GN=gck PE=1 SV=1
9	Q96YZ3	1.57e-24	107	399	0.218	0.286	GCK_SULTO Glycerate 2-kinase OS=Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) OX=273063 GN=gck PE=1 SV=1
10	F5H6E2	1.2	34.7	1039	0.115	0.058	F5H6E2_HUMAN Myosin IC OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=1
11	O00159	1.2	34.7	1063	0.115	0.056	MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4
12	Q9Y5M8	1.6	33.5	271	0.063	0.122	SRPRB_HUMAN Signal recognition particle receptor subunit beta OS=Homo sapiens OX=9606 GN=SRPRB PE=1 SV=3
13	Q9XZ29	2.1	33.9	1212	0.063	0.027	Q9XZ29_DROME EG:BACR25B3.9 protein OS=Drosophila melanogaster OX=7227 GN=Klp3A PE=1 SV=1
14	P47758	2.4	33.1	269	0.061	0.119	SRPRB_MOUSE Signal recognition particle receptor subunit beta OS=Mus musculus OX=10090 GN=Srprb PE=1 SV=1
15	P24783	3.9	32.7	546	0.034	0.033	DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DBP2 PE=1 SV=1
16	Q98TZ8	6.8	32.0	428	0.023	0.028	FLOT2_DANRE Flotillin-2a OS=Danio rerio OX=7955 GN=flot2a PE=2 SV=2
17	H2L003	9.9	31.6	840	0.063	0.039	H2L003_CAEEL LysM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lmd-3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13660 DUF4147	4.7e-83	289.9	Domain of unknown function (DUF4147)
2	PF12710 HAD	4.8e+02	12.6	haloacid dehalogenase-like hydrolase
3	PF05161 MOFRL	1.4e-32	123.5	MOFRL family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389175

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313432	0.976	Glyoxylate reductase/hydroxypyruvate reductase
2	9606.ENSP00000376840	0.914	Bisphosphoglycerate mutase
3	9606.ENSP00000387123	0.912	Alpha-aminoadipic semialdehyde dehydrogenase
4	9606.ENSP00000346827	0.906	4-trimethylaminobutyraldehyde dehydrogenase
5	9606.ENSP00000261733	0.905	Aldehyde dehydrogenase, mitochondrial
6	9606.ENSP00000366927	0.905	Aldehyde dehydrogenase X, mitochondrial
7	9606.ENSP00000297283	0.903	Phosphoglycerate mutase 2
8	9606.ENSP00000345774	0.903	Fatty aldehyde dehydrogenase
9	9606.ENSP00000359991	0.902	Phosphoglycerate mutase 1
10	9606.ENSP00000412189	0.902	Phosphoglycerate mutase family member 4
11	9606.ENSP00000320171	0.898	Pyruvate kinase PKM
12	9606.ENSP00000339933	0.890	Pyruvate kinase PKLR
13	9606.ENSP00000229270	0.881	Triosephosphate isomerase 1
14	9606.ENSP00000234590	0.877	Alpha-enolase
15	9606.ENSP00000324105	0.866	Beta-enolase
16	9606.ENSP00000405573	0.860	Glucose-6-phosphate isomerase
17	9606.ENSP00000437402	0.860	Gamma-enolase
18	9606.ENSP00000345555	0.856	Enolase 4
19	9606.ENSP00000363988	0.856	Belongs to the class I fructose-bisphosphate aldolase family
20	9606.ENSP00000378669	0.840	Fructose-bisphosphate aldolase A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016773	1.000	phosphotransferase activity, alcohol group as acceptor
GO:0016301	1.000	kinase activity
GO:0005515	0.998	protein binding
GO:0008887	0.994	glycerate kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044238	0.999	primary metabolic process
GO:0044281	0.997	small molecule metabolic process
GO:0019318	0.993	hexose metabolic process
GO:0046365	0.990	monosaccharide catabolic process
GO:0044237	0.973	cellular metabolic process
GO:0019320	0.949	hexose catabolic process
GO:0006807	0.784	nitrogen compound metabolic process
GO:1901564	0.719	organonitrogen compound metabolic process
GO:1901135	0.599	carbohydrate derivative metabolic process
GO:0006796	0.488	phosphate-containing compound metabolic process
GO:0019637	0.466	organophosphate metabolic process
GO:0016310	0.309	phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0005794	0.909	Golgi apparatus
GO:0043233	0.564	organelle lumen
GO:0070013	0.509	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
RHEA:23516	0.994	(R)-glycerate + ATP = (2R)-3-phosphoglycerate + ADP + H(+)
EC:2.7.1.31	0.994	glycerate 3-kinase.

[back to server]