StarFunc result for job id Q8IVU3

User Input

>input (1022 residues)
MYFCWGADSRELQRRRTAGSPGAELLQAASGERHSLLLLTNHRVLSCGDNSRGQLGRRGA
QRGELPEPIQALETLIVDLVSCGKEHSLAVCHKGRVFAWGAGSEGQLGIGEFKEISFTPK
KIMTLNDIKIIQVSCGHYHSLALSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEG
IPLAQVAAGGAHSFALSLCGTSFGWGSNSAGQLALSGRNVPVQSNKPLSVGALKNLGVVY
ISCGDAHTAVLTQDGKVFTFGDNRSGQLGYSPTPEKRGPQLVERIDGLVSQIDCGSYHTL
AYVHTTGQVVSFGHGPSDTSKPTHPEALTENFDISCLISAEDFVDVQVKHIFAGTYANFV
TTHQDTSSTRAPGKTLPEISRISQSMAEKWIAVKRRSTEHEMAKSEIRMIFSSPACLTAS
FLKKRGTGETTSIDVDLEMARDTFKKLTKKEWISSMITTCLEDDLLRALPCHSPHQEALS
VFLLLPECPVMHDSKNWKNLVVPFAKAVCEMSKQSLQVLKKCWAFLQESSLNPLIQMLKA
AIISQLLHQTKTEQDHCNVKALLGMMKELHKVNKANCRLPENTFNINELSNLLNFYIDRG
RQLFRDNHLIPAETPSPVIFSDFPFIFNSLSKIKLLQADSHIKMQMSEKKAYMLMHETIL
QKKDEFPPSPRFILRVRRSRLVKDALRQLSQAEATDFCKVLVVEFINEICPESGGVSSEF
FHCMFEEMTKPEYGMFMYPEMGSCMWFPAKPKPEKKRYFLFGMLCGLSLFNLNVANLPFP
LALYKKLLDQKPSLEDLKELSPRLGKSLQEVLDDAADDIGDALCIRFSIHWDQNDVDLIP
NGISIPVDQTNKRDYVSKYIDYIFNVSVKAVYEEFQRGFYRVCEKEILRHFYPEELMTAI
IGNTDYDWKQFEQNSKYEQGYQKSHPTIQLFWKAFHKLTLDEKKKFLFFLTGRDRLHARG
IQKMEIVFRCPETFSERDHPTSITCHNILSLPKYSTMERMEEALQVAINNNRGFVSPMLT
QS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F2Z461	0.929	0.946	0.000	1003	0.666	0.679	F2Z461.pdb.gz	HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus OX=10090 GN=Herc6 PE=2 SV=1
2	AFDB:Q8IVU3	1.000	1.000	0.000	1022	1.000	1.000	Q8IVU3.pdb.gz	HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens OX=9606 GN=HERC6 PE=1 SV=2
3	AFDB:Q9UII4	0.844	0.842	1.995E-92	1024	0.490	0.489	Q9UII4.pdb.gz	HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens OX=9606 GN=HERC5 PE=1 SV=2
4	AFDB:Q5GLZ8	0.849	0.823	8.692E-83	1057	0.369	0.357	Q5GLZ8.pdb.gz	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
5	AFDB:E8NHA2	0.731	0.708	1.437E-76	1062	0.328	0.315	E8NHA2.pdb.gz	E8NHA2_DROME HECT and RLD domain containing E3 ubiquitin ligase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Herc4 PE=1 SV=1
6	AFDB:Q05086	0.508	0.584	1.055E-33	875	0.172	0.201	Q05086.pdb.gz	UBE3A_HUMAN Ubiquitin-protein ligase E3A OS=Homo sapiens OX=9606 GN=UBE3A PE=1 SV=4
7	AFDB:Q5U5R9	0.500	0.639	1.494E-33	776	0.154	0.202	Q5U5R9.pdb.gz	HECD2_HUMAN Probable E3 ubiquitin-protein ligase HECTD2 OS=Homo sapiens OX=9606 GN=HECTD2 PE=1 SV=2
8	AFDB:Q9VTH1	0.520	0.544	3.893E-33	973	0.174	0.183	Q9VTH1.pdb.gz	Q9VTH1_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Ube3a PE=1 SV=1
9	AFDB:O94275	0.501	0.620	4.263E-32	807	0.165	0.209	O94275.pdb.gz	MUG30_SCHPO Probable E3 ubiquitin-protein ligase mug30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug30 PE=1 SV=1
10	AFDB:P40985	0.495	0.559	1.573E-31	892	0.165	0.189	P40985.pdb.gz	HUL4_YEAST Probable E3 ubiquitin-protein ligase HUL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HUL4 PE=1 SV=2
11	PDB:8gqeB	0.304	0.781	9.835E-23	386	0.104	0.275	8gqeB.pdb.gz
12	PDB:5tbkI	0.308	0.714	4.353E-20	419	0.086	0.210	5tbkI.pdb.gz
13	PDB:7mopA	0.216	0.095	6.440E-20	2445	0.119	0.050	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
14	PDB:7jq9A	0.247	0.112	5.433E-19	2427	0.113	0.047	7jq9A.pdb.gz
15	PDB:5xgsA	0.302	0.740	5.927E-19	398	0.100	0.256	5xgsA.pdb.gz
16	PDB:5t94A	0.308	0.659	1.684E-18	454	0.088	0.198	5t94A.pdb.gz
17	PDB:4d4oA	0.267	0.624	2.424E-14	414	0.068	0.167	4d4oA.pdb.gz	Structure of the Kti11/Kti13 Heterodimer and its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2.
18	PDB:7mq8LR	0.133	0.166	2.386E-7	773	0.075	0.100	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7vciR	0.149	0.142	2.603E-7	1082	0.082	0.078	7vciR.pdb.gz
20	PDB:6lqsB1	0.174	0.214	4.583E-7	806	0.064	0.081	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F2Z461	0.0	1351	1003	0.667	0.680	HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus OX=10090 GN=Herc6 PE=2 SV=1
2	Q5GLZ8	0.0	640	1057	0.389	0.377	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
3	Q6PAV2	0.0	666	1057	0.386	0.374	HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus OX=10090 GN=Herc4 PE=1 SV=2
4	Q8IVU3	0.0	2135	1022	1.000	1.000	HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens OX=9606 GN=HERC6 PE=1 SV=2
5	Q9UII4	0.0	957	1024	0.496	0.495	HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens OX=9606 GN=HERC5 PE=1 SV=2
6	E8NHA2	5.27e-169	525	1062	0.341	0.328	E8NHA2_DROME HECT and RLD domain containing E3 ubiquitin ligase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Herc4 PE=1 SV=1
7	O08759	8.00e-62	229	870	0.148	0.174	UBE3A_MOUSE Ubiquitin-protein ligase E3A OS=Mus musculus OX=10090 GN=Ube3a PE=1 SV=2
8	F1M7B8	8.92e-62	229	868	0.149	0.175	F1M7B8_RAT Ubiquitin-protein ligase E3A OS=Rattus norvegicus OX=10116 GN=Ube3a PE=1 SV=2
9	A0A8I5ZM14	1.67e-61	228	867	0.149	0.175	A0A8I5ZM14_RAT Ubiquitin-protein ligase E3A OS=Rattus norvegicus OX=10116 GN=Ube3a PE=1 SV=1
10	Q05086	5.06e-61	226	875	0.144	0.168	UBE3A_HUMAN Ubiquitin-protein ligase E3A OS=Homo sapiens OX=9606 GN=UBE3A PE=1 SV=4
11	Q9VTH1	1.52e-56	214	973	0.133	0.140	Q9VTH1_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Ube3a PE=1 SV=1
12	D6RCL5	7.98e-47	169	240	0.089	0.379	D6RCL5_HUMAN HECT and RLD domain containing E3 ubiquitin protein ligase 4 (Fragment) OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
13	Q5U5R9	6.30e-45	177	776	0.118	0.156	HECD2_HUMAN Probable E3 ubiquitin-protein ligase HECTD2 OS=Homo sapiens OX=9606 GN=HECTD2 PE=1 SV=2
14	P40985	7.34e-45	177	892	0.119	0.137	HUL4_YEAST Probable E3 ubiquitin-protein ligase HUL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HUL4 PE=1 SV=2
15	O94275	1.92e-43	172	807	0.123	0.156	MUG30_SCHPO Probable E3 ubiquitin-protein ligase mug30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug30 PE=1 SV=1
16	A0A0G2JTH7	7.06e-43	170	760	0.115	0.155	A0A0G2JTH7_RAT Ubiquitin protein ligase E3A OS=Rattus norvegicus OX=10116 GN=Ube3a PE=1 SV=2
17	Q9FN03	5.67e-41	159	440	0.099	0.230	UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1
18	O13834	3.71e-39	161	3227	0.109	0.034	PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptr1 PE=1 SV=1
19	Q5U1Z5	2.30e-37	148	440	0.102	0.236	Q5U1Z5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=2 SV=1
20	Q9LFS0	2.83e-37	147	396	0.097	0.250	Q9LFS0_ARATH At5g16040 OS=Arabidopsis thaliana OX=3702 GN=At5g16040 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00632 HECT	1.3e-64	230.2	HECT-domain (ubiquitin-transferase)
2	PF00415 RCC1	1e-58	207.1	Regulator of chromosome condensation (RCC1) repeat
3	PF13540 RCC1_2	4.2e-34	126.9	Regulator of chromosome condensation (RCC1) repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264346

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368699	0.944	Ubiquitin-like protein ISG15
2	9606.ENSP00000371471	0.919	Radical S-adenosyl methionine domain-containing protein 2
3	9606.ENSP00000381601	0.916	Interferon-induced GTP-binding protein Mx1
4	9606.ENSP00000377344	0.912	Probable ATP-dependent RNA helicase DDX60
5	9606.ENSP00000360869	0.908	Interferon-induced protein with tetratricopeptide repeats 1
6	9606.ENSP00000359783	0.900	Interferon-induced protein 44
7	9606.ENSP00000359787	0.899	Interferon-induced protein 44-like
8	9606.ENSP00000360883	0.890	Interferon-induced protein with tetratricopeptide repeats 3
9	9606.ENSP00000228928	0.886	2'-5'-oligoadenylate synthase 3
10	9606.ENSP00000342278	0.885	2'-5'-oligoadenylate synthase 2
11	9606.ENSP00000215794	0.878	Ubl carboxyl-terminal hydrolase 18
12	9606.ENSP00000354822	0.873	XIAP-associated factor 1
13	9606.ENSP00000287156	0.868	Ubiquitin/ISG15-conjugating enzyme E2 L6
14	9606.ENSP00000369213	0.865	Probable ATP-dependent RNA helicase DDX58
15	9606.ENSP00000257570	0.864	2'-5'-oligoadenylate synthase-like protein
16	9606.ENSP00000342513	0.853	Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis . However, it has also been shown to have a pro-apoptotic activity . Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation is required for entry of the virus into cells . ECO:0000269\|PubMed:17823654, ECO:0000269\|PubMed:25757571,
17	9606.ENSP00000388001	0.839	2'-5'-oligoadenylate synthase 1
18	9606.ENSP00000263642	0.817	Interferon-induced helicase C domain-containing protein 1
19	9606.ENSP00000263549	0.808	poly(ADP-ribose) polymerase family member 12
20	9606.ENSP00000360891	0.798	Interferon-induced protein with tetratricopeptide repeats 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:1901363	0.943	heterocyclic compound binding
GO:0097159	0.942	organic cyclic compound binding
GO:0003676	0.825	nucleic acid binding
GO:0003723	0.654	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0044419	0.921	biological process involved in interspecies interaction between organisms
GO:0050896	0.916	response to stimulus
GO:0065007	0.843	biological regulation
GO:0009605	0.822	response to external stimulus
GO:0050789	0.808	regulation of biological process
GO:0043207	0.778	response to external biotic stimulus
GO:0051707	0.773	response to other organism
GO:0032502	0.569	developmental process
GO:0050794	0.540	regulation of cellular process
GO:0048856	0.538	anatomical structure development
GO:0008152	0.492	metabolic process
GO:0071704	0.480	organic substance metabolic process
GO:0044238	0.435	primary metabolic process
GO:0048468	0.417	cell development
GO:0006807	0.393	nitrogen compound metabolic process
GO:0043170	0.387	macromolecule metabolic process
GO:0030097	0.350	hemopoiesis
GO:0006950	0.313	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0070013	0.996	intracellular organelle lumen
GO:0005654	0.992	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]