StarFunc result for job id Q8IVV2

User Input

>input (2067 residues)
MMPQKKRRRKKDIDFLALYEAELLNYASEDDEGELEHEYYKARVYEVVTATGDVRGAGTD
ANVFITLFGENGLSPKLQLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNAS
WYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPRGNKYEVKVYT
GDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDRFILDAPDLGQLMKINVGH
NNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAITYIV
TVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGVFDRGRTDIFHIELAVLLSPLSR
VSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKK
RLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNPNNKWFKPGIIEKFRIEL
PDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMT
AEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFE
KGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLD
KDKDDGQLVRELLPSDSSATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVL
LVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQ
YTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYG
EKGKTEVLFLSSRSKVFERASKDTFQTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDR
IDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNL
ALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSI
EIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDG
SIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTN
KREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGA
ETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQI
FTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYK
IKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDR
SSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSR
AFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESC
WLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWT
GDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRI
DGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTS
YTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSL
GHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACAN
NKICDELEETTYEIVIETGNGGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTDT
FEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLK
RKRKYFKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTG
KRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGV
ATIFNCGRWLDKKRGDGLTWRDLFPSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:C8YR32	0.972	0.972	0.000	2068	0.945	0.945	C8YR32.pdb.gz	LOXH1_MOUSE Lipoxygenase homology domain-containing protein 1 OS=Mus musculus OX=10090 GN=Loxhd1 PE=2 SV=1
2	AFDB:Q8R526	0.060	0.051	1.491E-11	2615	0.096	0.076	Q8R526.pdb.gz	PK1L1_MOUSE Polycystin-1-like protein 1 OS=Mus musculus OX=10090 GN=Pkd1l1 PE=1 SV=2
3	AFDB:Q2EG98	0.058	0.054	3.799E-9	2201	0.033	0.031	Q2EG98.pdb.gz	PK1L3_MOUSE Polycystin-1-like protein 3 OS=Mus musculus OX=10090 GN=Pkd1l3 PE=1 SV=2
4	AFDB:D4G3R4	0.058	0.056	5.840E-9	2347	0.116	0.102	D4G3R4.pdb.gz	WAPA_BACNB tRNA(Glu)-specific nuclease WapA OS=Bacillus subtilis subsp. natto (strain BEST195) OX=645657 GN=wapA PE=1 SV=2
5	AFDB:Q9NTG1	0.059	0.054	7.415E-9	2253	0.066	0.060	Q9NTG1.pdb.gz	PKDRE_HUMAN Polycystin family receptor for egg jelly OS=Homo sapiens OX=9606 GN=PKDREJ PE=2 SV=2
6	AFDB:Q7Z443	0.057	0.068	1.592E-8	1732	0.034	0.041	Q7Z443.pdb.gz	PK1L3_HUMAN Polycystin-1-like protein 3 OS=Homo sapiens OX=9606 GN=PKD1L3 PE=1 SV=1
7	AFDB:Q9Z0T6	0.057	0.056	2.333E-8	2126	0.065	0.063	Q9Z0T6.pdb.gz	PKDRE_MOUSE Polycystin family receptor for egg jelly OS=Mus musculus OX=10090 GN=Pkdrej PE=2 SV=1
8	AFDB:E7F4H1	0.067	0.066	2.825E-8	2097	0.099	0.098	E7F4H1.pdb.gz	E7F4H1_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=2
9	AFDB:Q9NZM1	0.062	0.062	3.587E-8	2061	0.100	0.100	Q9NZM1.pdb.gz	MYOF_HUMAN Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1
10	AFDB:Q5SPC5	0.069	0.071	5.783E-8	1992	0.096	0.099	Q5SPC5.pdb.gz	OTOF_DANRE Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1
11	PDB:7ttjB	0.052	0.172	8.338E-7	590	0.030	0.105	7ttjB.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
12	PDB:7ttjA	0.049	0.153	1.551E-6	643	0.020	0.065	7ttjA.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
13	PDB:7ttlC	0.051	0.165	2.385E-6	617	0.025	0.083	7ttlC.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
14	PDB:2p0mA	0.051	0.150	3.494E-6	662	0.016	0.051	2p0mA.pdb.gz	Conformational flexibility in mammalian 15S-lipoxygenase: Reinterpretation of the crystallographic data.
15	PDB:3v99B	0.050	0.156	3.494E-6	639	0.020	0.064	3v99B.pdb.gz	Conversion of human 5-lipoxygenase to a 15-lipoxygenase by a point mutation to mimic phosphorylation at Serine-663.
16	PDB:4nreA	0.051	0.151	1.100E-5	675	0.015	0.044	4nreA.pdb.gz	The structure of human 15-lipoxygenase-2 with a substrate mimic.
17	PDB:2hyeA	0.055	0.078	1.396E-5	1140	0.071	0.128	2hyeA.pdb.gz	Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
18	PDB:6ncfB	0.050	0.147	2.251E-5	676	0.020	0.061	6ncfB.pdb.gz	Structural and mechanistic insights into 5-lipoxygenase inhibition by natural products.
19	PDB:2pplA	0.053	0.236	3.299E-5	449	0.010	0.047	2pplA.pdb.gz	Two novel human pancreatic lipase related proteins, hPLRP1 and hPLRP2. Differences in colipase dependence and in lipase activity
20	PDB:6xk9Y	0.045	0.062	4.189E-5	1106	0.060	0.111	6xk9Y.pdb.gz	CC-90009, a novel cereblon E3 ligase modulator, targets acute myeloid leukemia blasts and leukemia stem cells.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C8YR32	0.0	4029	2068	0.946	0.945	LOXH1_MOUSE Lipoxygenase homology domain-containing protein 1 OS=Mus musculus OX=10090 GN=Loxhd1 PE=2 SV=1
2	Q8IVV2	0.0	4265	2067	1.000	1.000	LOXH1_HUMAN Lipoxygenase homology domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LOXHD1 PE=2 SV=4
3	Q7Z443	1.38e-15	85.9	1732	0.021	0.025	PK1L3_HUMAN Polycystin-1-like protein 3 OS=Homo sapiens OX=9606 GN=PKD1L3 PE=1 SV=1
4	Q2EG98	1.14e-14	83.2	2201	0.023	0.022	PK1L3_MOUSE Polycystin-1-like protein 3 OS=Mus musculus OX=10090 GN=Pkd1l3 PE=1 SV=2
5	Q8TDX9	1.98e-13	79.0	2849	0.021	0.015	PK1L1_HUMAN Polycystin-1-like protein 1 OS=Homo sapiens OX=9606 GN=PKD1L1 PE=1 SV=1
6	Q9ERV0	2.60e-13	78.6	4283	0.027	0.013	Q9ERV0_RAT Pkd1 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
7	A0A8I6AC84	2.62e-13	78.6	4254	0.025	0.012	A0A8I6AC84_RAT Polycystin 1, transient receptor potential channel interacting OS=Rattus norvegicus OX=10116 GN=Pkd1 PE=3 SV=1
8	F1MAD3	2.71e-13	78.6	4292	0.027	0.013	F1MAD3_RAT Polycystin 1, transient receptor potential channel interacting OS=Rattus norvegicus OX=10116 GN=Pkd1 PE=3 SV=3
9	O08852	3.21e-13	78.6	4293	0.019	0.009	PKD1_MOUSE Polycystin-1 OS=Mus musculus OX=10090 GN=Pkd1 PE=1 SV=2
10	P98161	4.92e-13	77.8	4303	0.020	0.010	PKD1_HUMAN Polycystin-1 OS=Homo sapiens OX=9606 GN=PKD1 PE=1 SV=3
11	Q9Z0T6	9.13e-13	76.6	2126	0.020	0.020	PKDRE_MOUSE Polycystin family receptor for egg jelly OS=Mus musculus OX=10090 GN=Pkdrej PE=2 SV=1
12	Q8R526	4.51e-12	74.3	2615	0.021	0.016	PK1L1_MOUSE Polycystin-1-like protein 1 OS=Mus musculus OX=10090 GN=Pkd1l1 PE=1 SV=2
13	Q9NTG1	6.61e-11	70.5	2253	0.019	0.018	PKDRE_HUMAN Polycystin family receptor for egg jelly OS=Homo sapiens OX=9606 GN=PKDREJ PE=2 SV=2
14	A2RSQ0	3.58e-10	68.2	1274	0.022	0.036	DEN5B_MOUSE DENN domain-containing protein 5B OS=Mus musculus OX=10090 GN=Dennd5b PE=1 SV=2
15	Q6ZUT9	3.70e-10	68.2	1274	0.022	0.036	DEN5B_HUMAN DENN domain-containing protein 5B OS=Homo sapiens OX=9606 GN=DENND5B PE=1 SV=2
16	E7FKV8	7.69e-10	67.0	2742	0.019	0.014	PK1L1_ORYLA Polycystin-1-like protein 1 OS=Oryzias latipes OX=8090 GN=pkd1l1 PE=1 SV=2
17	A0A087X109	1.30e-09	60.5	139	0.019	0.281	A0A087X109_HUMAN Polyunsaturated fatty acid 5-lipoxygenase OS=Homo sapiens OX=9606 GN=ALOX5 PE=4 SV=1
18	Q6IQ26	6.38e-09	63.9	1287	0.025	0.040	DEN5A_HUMAN DENN domain-containing protein 5A OS=Homo sapiens OX=9606 GN=DENND5A PE=1 SV=2
19	G3V7Q0	6.54e-09	63.9	1287	0.017	0.028	DEN5A_RAT DENN domain-containing protein 5A OS=Rattus norvegicus OX=10116 GN=Dennd5a PE=2 SV=1
20	Q6PAL8	7.94e-09	63.5	1287	0.025	0.040	DEN5A_MOUSE DENN domain-containing protein 5A OS=Mus musculus OX=10090 GN=Dennd5a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06232 ATS3	1.5e-18	78.3	Embryo-specific protein 3, (ATS3)
2	PF01477 PLAT	2e-278	916.9	PLAT/LH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9940.ENSOARP00000003428

Rank	PPI partner	STRING score	Description
1	9940.ENSOARP00000003938	0.656	Solute carrier family 4, sodium borate transporter, member 11
2	9940.ENSOARP00000013634	0.654	Transmembrane channel-like 1
3	9940.ENSOARP00000011550	0.651	Transmembrane protease, serine 3
4	9940.ENSOARP00000011530	0.646	ATP/GTP binding protein-like 1
5	9940.ENSOARP00000009779	0.584	KN motif and ankyrin repeat domains 4
6	9940.ENSOARP00000021089	0.583	Collagen, type VIII, alpha 2
7	9940.ENSOARP00000014559	0.579	Cyclic nucleotide-gated cation channel alpha-3
8	9940.ENSOARP00000003338	0.551	Plasminogen activator, tissue
9	9940.ENSOARP00000005011	0.541	SH3 and PX domains 2A
10	9940.ENSOARP00000003850	0.538	SKI family transcriptional corepressor 2
11	9940.ENSOARP00000004516	0.538	Myosin IIIA
12	9940.ENSOARP00000007136	0.537	Transmembrane channel-like 2
13	9940.ENSOARP00000007149	0.534	Myosin VI
14	9940.ENSOARP00000000878	0.508	Myosin XVA
15	9940.ENSOARP00000022678	0.507	Exocyst complex component 5
16	9940.ENSOARP00000017305	0.503	Otoancorin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.941	catalytic activity
GO:0016702	0.430	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0007605	0.984	sensory perception of sound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032420	0.998	stereocilium
GO:0005622	0.824	intracellular anatomical structure
GO:0043229	0.668	intracellular organelle
GO:0043227	0.663	membrane-bounded organelle
GO:0005737	0.642	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.13.11.-	0.430	With incorporation of two atoms of oxygen.

[back to server]