StarFunc result for job id Q8IW03

User Input

>input (269 residues)
MLFFTQCFGAVLDLIHLRFQHYKAKRVFSAAGQLVCVVNPTHNLKYVSSRRAVTQSAPEQ
GSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEAGLHANPVTPCLCMCPLFSCQWEGRL
EVVVPHLRQIHRVDILQGAEIVFLATDMHLPAPADWIIMHSCLGHHFLLVLRKQERHEGH
PQFFATMMLIGTPTQADCFTYRLELNRNHRRLKWEATPRSVLECVDSVITDGDCLVLNTS
LAQLFSDNGSLAIGIAITATEVLPSEAEM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IW03	1.000	1.000	3.667E-54	269	1.000	1.000	Q8IW03.pdb.gz	SIAH3_HUMAN Seven in absentia homolog 3 OS=Homo sapiens OX=9606 GN=SIAH3 PE=1 SV=3
2	AFDB:Q06986	0.554	0.461	7.286E-24	325	0.320	0.265	Q06986.pdb.gz	SIAH2_MOUSE E3 ubiquitin-protein ligase SIAH2 OS=Mus musculus OX=10090 GN=Siah2 PE=1 SV=2
3	AFDB:P61092	0.552	0.527	9.756E-23	282	0.312	0.298	P61092.pdb.gz	SIA1A_MOUSE E3 ubiquitin-protein ligase SIAH1A OS=Mus musculus OX=10090 GN=Siah1a PE=1 SV=1
4	AFDB:P21461	0.552	0.475	8.237E-22	314	0.316	0.271	P21461.pdb.gz	SINA_DROME E3 ubiquitin-protein ligase sina OS=Drosophila melanogaster OX=7227 GN=sina PE=1 SV=2
5	AFDB:Q965X6	0.555	0.361	8.758E-21	419	0.275	0.177	Q965X6.pdb.gz	SIAH1_CAEEL E3 ubiquitin-protein ligase siah-1 OS=Caenorhabditis elegans OX=6239 GN=siah-1 PE=1 SV=3
6	AFDB:Q8T3Y0	0.552	0.427	9.864E-20	351	0.223	0.171	Q8T3Y0.pdb.gz	SINAL_DROME Probable E3 ubiquitin-protein ligase sinah OS=Drosophila melanogaster OX=7227 GN=sinah PE=1 SV=2
7	AFDB:Q8S3N1	0.538	0.473	1.335E-15	309	0.160	0.139	Q8S3N1.pdb.gz	SINA5_ARATH E3 ubiquitin-protein ligase SINAT5 OS=Arabidopsis thaliana OX=3702 GN=SINAT5 PE=1 SV=2
8	AFDB:Q9STN8	0.530	0.443	1.335E-15	327	0.164	0.135	Q9STN8.pdb.gz	SINA4_ARATH E3 ubiquitin-protein ligase SINAT4 OS=Arabidopsis thaliana OX=3702 GN=SINAT4 PE=1 SV=1
9	AFDB:Q84JL3	0.523	0.438	1.999E-15	326	0.164	0.135	Q84JL3.pdb.gz	SINA3_ARATH E3 ubiquitin-protein ligase SINAT3 OS=Arabidopsis thaliana OX=3702 GN=SINAT3 PE=1 SV=1
10	AFDB:Q9M2P4	0.517	0.455	3.359E-15	308	0.156	0.136	Q9M2P4.pdb.gz	SINA2_ARATH E3 ubiquitin-protein ligase SINAT2 OS=Arabidopsis thaliana OX=3702 GN=SINAT2 PE=1 SV=1
11	PDB:6xwuA	0.092	0.135	5.114E-2	138	0.041	0.080	6xwuA.pdb.gz
12	PDB:6xwvD	0.087	0.139	1.363E-1	123	0.037	0.081	6xwvD.pdb.gz	Structural basis for centromere maintenance by Drosophila CENP-A chaperone CAL1.
13	PDB:4gslA	0.082	0.049	1.444E-1	598	0.063	0.028	4gslA.pdb.gz	Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.
14	PDB:4o9yA	0.132	0.022	1.529E-1	2490	0.037	0.004	4o9yA.pdb.gz
15	PDB:4akrB	0.110	0.118	1.926E-1	245	0.059	0.065	4akrB.pdb.gz
16	PDB:7pdzE	0.114	0.114	2.161E-1	272	0.071	0.070	7pdzE.pdb.gz	A barbed end interference mechanism reveals how capping protein promotes nucleation in branched actin networks.
17	PDB:4n2iA	0.165	0.081	2.426E-1	662	0.030	0.012	4n2iA.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
18	PDB:4gskB	0.082	0.049	3.055E-1	572	0.067	0.031	4gskB.pdb.gz	Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.
19	PDB:6b9tD	0.098	0.067	4.317E-1	453	0.037	0.022	6b9tD.pdb.gz	Structural basis for methylphosphonate biosynthesis.
20	PDB:7qpdT	0.097	0.078	4.574E-1	348	0.056	0.043	7qpdT.pdb.gz	Molecular basis of MHC I quality control in the peptide loading complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IW03	0.0	551	269	1.000	1.000	SIAH3_HUMAN Seven in absentia homolog 3 OS=Homo sapiens OX=9606 GN=SIAH3 PE=1 SV=3
2	Q06986	2.57e-59	193	325	0.346	0.286	SIAH2_MOUSE E3 ubiquitin-protein ligase SIAH2 OS=Mus musculus OX=10090 GN=Siah2 PE=1 SV=2
3	Q8R4T2	2.57e-59	193	325	0.346	0.286	SIAH2_RAT E3 ubiquitin-protein ligase SIAH2 OS=Rattus norvegicus OX=10116 GN=Siah2 PE=1 SV=2
4	O43255	2.97e-59	192	324	0.346	0.287	SIAH2_HUMAN E3 ubiquitin-protein ligase SIAH2 OS=Homo sapiens OX=9606 GN=SIAH2 PE=1 SV=1
5	P21461	2.14e-58	190	314	0.327	0.280	SINA_DROME E3 ubiquitin-protein ligase sina OS=Drosophila melanogaster OX=7227 GN=sina PE=1 SV=2
6	Q06985	8.72e-58	187	282	0.320	0.305	SIA1B_MOUSE E3 ubiquitin-protein ligase SIAH1B OS=Mus musculus OX=10090 GN=Siah1b PE=2 SV=2
7	P61092	9.40e-58	187	282	0.320	0.305	SIA1A_MOUSE E3 ubiquitin-protein ligase SIAH1A OS=Mus musculus OX=10090 GN=Siah1a PE=1 SV=1
8	Q920M9	9.40e-58	187	282	0.320	0.305	SIAH1_RAT E3 ubiquitin-protein ligase SIAH1 OS=Rattus norvegicus OX=10116 GN=Siah1 PE=1 SV=2
9	Q8IUQ4	1.13e-57	187	282	0.320	0.305	SIAH1_HUMAN E3 ubiquitin-protein ligase SIAH1 OS=Homo sapiens OX=9606 GN=SIAH1 PE=1 SV=2
10	Q965X6	1.19e-47	165	419	0.297	0.191	SIAH1_CAEEL E3 ubiquitin-protein ligase siah-1 OS=Caenorhabditis elegans OX=6239 GN=siah-1 PE=1 SV=3
11	Q8T3Y0	3.58e-28	112	351	0.245	0.188	SINAL_DROME Probable E3 ubiquitin-protein ligase sinah OS=Drosophila melanogaster OX=7227 GN=sinah PE=1 SV=2
12	Q9STN8	2.12e-11	65.5	327	0.145	0.119	SINA4_ARATH E3 ubiquitin-protein ligase SINAT4 OS=Arabidopsis thaliana OX=3702 GN=SINAT4 PE=1 SV=1
13	P93748	2.67e-10	62.0	305	0.141	0.125	SINA1_ARATH Putative E3 ubiquitin-protein ligase SINAT1 OS=Arabidopsis thaliana OX=3702 GN=SINAT1 PE=1 SV=1
14	Q84JL3	3.65e-10	61.6	326	0.149	0.123	SINA3_ARATH E3 ubiquitin-protein ligase SINAT3 OS=Arabidopsis thaliana OX=3702 GN=SINAT3 PE=1 SV=1
15	Q9M2P4	6.46e-10	60.8	308	0.149	0.130	SINA2_ARATH E3 ubiquitin-protein ligase SINAT2 OS=Arabidopsis thaliana OX=3702 GN=SINAT2 PE=1 SV=1
16	Q8S3N1	7.76e-10	60.5	309	0.145	0.126	SINA5_ARATH E3 ubiquitin-protein ligase SINAT5 OS=Arabidopsis thaliana OX=3702 GN=SINAT5 PE=1 SV=2
17	Q10L91	1.80e-09	59.3	301	0.134	0.120	DIS1_ORYSJ E3 ubiquitin-protein ligase DIS1 OS=Oryza sativa subsp. japonica OX=39947 GN=DIS1 PE=1 SV=1
18	Q93WE4	6.08e-09	57.0	216	0.156	0.194	SINA6_ARATH Probable inactive E3 ubiquitin-protein ligase SINAT6 OS=Arabidopsis thaliana OX=3702 GN=SINAT6 PE=1 SV=1
19	P79114	2.5	32.3	2052	0.059	0.008	MYO10_BOVIN Unconventional myosin-X OS=Bos taurus OX=9913 GN=MYO10 PE=1 SV=1
20	Q960D2	2.7	32.0	665	0.082	0.033	Q960D2_DROME SD06673p OS=Drosophila melanogaster OX=7227 GN=Cnb PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03145 Sina	8.5e-39	145.2	Seven in absentia protein family
2	PF13512 TPR_18	6.8e+02	11.8	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000383256

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351214	0.777	Mitochondrial import receptor subunit TOM7 homolog
2	9606.ENSP00000287322	0.688	BAG family molecular chaperone regulator 4
3	9606.ENSP00000258149	0.614	E3 ubiquitin-protein ligase Mdm2
4	9606.ENSP00000364805	0.614	Heat shock 70 kDa protein 1-like
5	9606.ENSP00000355865	0.537	E3 ubiquitin-protein ligase parkin
6	9606.ENSP00000274673	0.518	Protein FAM217A
7	9606.ENSP00000323928	0.518	Olfactory receptor 8H3
8	9606.ENSP00000344860	0.504	Insulin growth factor-like family member 3
9	9606.ENSP00000311038	0.501	Olfactory receptor 6M1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.741	catalytic activity
GO:0016740	0.633	transferase activity
GO:0140096	0.430	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048523	0.987	negative regulation of cellular process
GO:1903533	0.987	regulation of protein targeting
GO:1903747	0.982	regulation of establishment of protein localization to mitochondrion
GO:0065008	0.974	regulation of biological quality
GO:0031647	0.964	regulation of protein stability
GO:1904950	0.931	negative regulation of establishment of protein localization
GO:0051051	0.885	negative regulation of transport
GO:0051224	0.858	negative regulation of protein transport
GO:0032387	0.819	negative regulation of intracellular transport
GO:0090317	0.721	negative regulation of intracellular protein transport
GO:0009987	0.704	cellular process
GO:0071704	0.661	organic substance metabolic process
GO:0006807	0.617	nitrogen compound metabolic process
GO:0044238	0.582	primary metabolic process
GO:1901564	0.577	organonitrogen compound metabolic process
GO:0043170	0.555	macromolecule metabolic process
GO:0019538	0.535	protein metabolic process
GO:0006508	0.527	proteolysis
GO:0048518	0.441	positive regulation of biological process
GO:0009056	0.348	catabolic process
GO:0048522	0.341	positive regulation of cellular process
GO:0050896	0.324	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.997	nucleoplasm
GO:0005739	0.989	mitochondrion
GO:0005829	0.962	cytosol
GO:0016020	0.368	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.633	Transferases.

[back to server]