StarFunc result for job id Q8IW35

User Input

>input (865 residues)
MAVARVDAALPPGEGSVVNWSGQGLQKLGPNLPCEADIHTLILDKNQIIKLENLEKCKRL
IQLSVANNRLVRMMGVAKLTLLRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQI
NSCTALQHLDLSDNNISQIGDLSKLVSLKTLLLHGNIITSLRMAPAYLPRSLAILSLAEN
EIRDLNEISFLASLTELEQLSIMNNPCVMATPSIPGFDYRPYIVSWCLNLRVLDGYVISQ
KESLKAEWLYSQGKGRAYRPGQHIQLVQYLATVCPLTSTLGLQTAEDAKLEKILSKQRFH
QRQLMNQSQNEELSPLVPVETRASLIPEHSSPVQDCQISQESEPVIQVNSWVGINSNDDQ
LFAVKNNFPASVHTTRYSRNDLHLEDIQTDEDKLNCSLLSSESTFMPVASGLSPLSPTVE
LRLQGINLGLEDDGVADESVKGLESQVLDKEEEQPLWAANENSVQMMRSEINTEVNEKAG
LLPCPEPTIISAILKDDNHSLTFFPESTEQKQSDIKKPENTQPENKETISQATSEKLPMI
LTQRSVALGQDKVALQKLNDAATKLQACWRGFYARNYNPQAKDVRYEIRLRRMQEHIVCL
TDEIRRLRKERDEERIKKFVQEEAFRFLWNQVRSLQVWQQTVDQRLSSWHTDVPPISSTL
VPSKHPLFTQSQESSCDQNADWFIASDVAPQEKSLPEFPDSGFHSSLTEQVHSLQHSLDF
EKSSTEGSESSIMGNSIDTVRYGKESDLGDVSEEHGEWNKESSNNEQDNSLLEQYLTSVQ
QLEDADERTNFDTETRDSKLHIACFPVQLDTLSDGASVDESHGISPPLQGEISQTQENSK
LNAEVQGQQPECDSTFQLLHVGVTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IW35	1.000	1.000	0.000	865	1.000	1.000	Q8IW35.pdb.gz	CEP97_HUMAN Centrosomal protein of 97 kDa OS=Homo sapiens OX=9606 GN=CEP97 PE=1 SV=1
2	AFDB:Q9CZ62	0.497	0.502	2.624E-85	856	0.756	0.764	Q9CZ62.pdb.gz	CEP97_MOUSE Centrosomal protein of 97 kDa OS=Mus musculus OX=10090 GN=Cep97 PE=1 SV=1
3	AFDB:Q9VQV7	0.343	0.367	5.123E-34	806	0.253	0.272	Q9VQV7.pdb.gz	Q9VQV7_DROME Centrosomal protein 97kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=Cep97 PE=3 SV=3
4	PDB:6hkwA	0.215	0.557	4.035E-11	306	0.058	0.163	6hkwA.pdb.gz
5	AFDB:M0R9T2	0.212	0.151	4.651E-8	1258	0.133	0.091	M0R9T2.pdb.gz	M0R9T2_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=3
6	PDB:7tvfD	0.197	0.321	7.758E-8	515	0.065	0.109	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
7	PDB:7p5vB	0.207	0.241	1.366E-7	732	0.064	0.075	7p5vB.pdb.gz
8	PDB:7lt9A	0.200	0.638	2.061E-7	251	0.072	0.247	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.
9	PDB:1m9sA	0.165	0.267	2.405E-7	523	0.054	0.090	1m9sA.pdb.gz
10	PDB:3jb9j	0.150	0.760	6.729E-7	160	0.045	0.244	3jb9j.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
11	PDB:6gffI	0.184	0.278	4.072E-6	551	0.068	0.107	6gffI.pdb.gz
12	PDB:7a5pW	0.161	0.735	5.267E-6	174	0.054	0.270	7a5pW.pdb.gz	Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.
13	PDB:5yq5B	0.173	0.421	7.550E-6	306	0.057	0.160	5yq5B.pdb.gz
14	PDB:2ft3F	0.165	0.415	1.199E-5	305	0.053	0.151	2ft3F.pdb.gz
15	AFDB:Q9U252	0.089	0.122	8.366E-2	589	0.089	0.131	Q9U252.pdb.gz	Q9U252_CAEEL Arginine/serine-rich protein PNISR OS=Caenorhabditis elegans OX=6239 GN=rsy-1 PE=1 SV=2
16	AFDB:Q86AD8	0.085	0.062	1.329E-1	1207	0.086	0.061	Q86AD8.pdb.gz	Q86AD8_DICDI RING zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1106 PE=4 SV=1
17	AFDB:F4JQZ3	0.084	0.081	1.551E-1	920	0.090	0.085	F4JQZ3.pdb.gz	REN1_ARATH Rho GTPase-activating protein REN1 OS=Arabidopsis thaliana OX=3702 GN=REN1 PE=1 SV=2
18	AFDB:Q9I7T2	0.081	0.079	1.810E-1	887	0.104	0.101	Q9I7T2.pdb.gz	Q9I7T2_DROME Ensconsin, isoform A OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=2
19	AFDB:Q24266	0.059	0.072	2.006E-1	644	0.090	0.121	Q24266.pdb.gz	BTD_DROME Transcription factor btd OS=Drosophila melanogaster OX=7227 GN=btd PE=2 SV=1
20	AFDB:R4GLV5	0.055	0.044	2.112E-1	1116	0.087	0.067	R4GLV5.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IW35	0.0	1778	865	1.000	1.000	CEP97_HUMAN Centrosomal protein of 97 kDa OS=Homo sapiens OX=9606 GN=CEP97 PE=1 SV=1
2	Q9CZ62	0.0	1309	856	0.765	0.773	CEP97_MOUSE Centrosomal protein of 97 kDa OS=Mus musculus OX=10090 GN=Cep97 PE=1 SV=1
3	Q9VQV7	1.62e-78	273	806	0.164	0.176	Q9VQV7_DROME Centrosomal protein 97kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=Cep97 PE=3 SV=3
4	Q91YK0	4.28e-13	75.5	686	0.075	0.095	LRC49_MOUSE Leucine-rich repeat-containing protein 49 OS=Mus musculus OX=10090 GN=Lrrc49 PE=1 SV=1
5	Q8IUZ0	7.10e-13	74.7	686	0.076	0.096	LRC49_HUMAN Leucine-rich repeat-containing protein 49 OS=Homo sapiens OX=9606 GN=LRRC49 PE=1 SV=2
6	Q15435	1.27e-12	72.4	360	0.073	0.175	PP1R7_HUMAN Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7 PE=1 SV=1
7	P0DJM0	2.35e-12	73.2	800	0.071	0.076	INLA_LISMO Internalin A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=inlA PE=1 SV=1
8	A2AL36	9.87e-12	71.6	2334	0.071	0.026	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
9	Q3UM45	1.52e-11	69.3	361	0.069	0.166	PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus OX=10090 GN=Ppp1r7 PE=1 SV=2
10	Q8KC98	2.46e-11	70.1	1102	0.075	0.059	Q8KC98_CHLTE Rab family protein OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=CT1526 PE=1 SV=1
11	Q9D5E4	5.70e-11	68.2	523	0.058	0.096	DRC3_MOUSE Dynein regulatory complex subunit 3 OS=Mus musculus OX=10090 GN=Drc3 PE=1 SV=1
12	Q9H069	2.49e-10	66.2	523	0.059	0.098	DRC3_HUMAN Dynein regulatory complex subunit 3 OS=Homo sapiens OX=9606 GN=DRC3 PE=1 SV=2
13	Q9Y2I1	2.69e-10	67.0	1504	0.098	0.057	NISCH_HUMAN Nischarin OS=Homo sapiens OX=9606 GN=NISCH PE=1 SV=3
14	P43333	3.02e-10	63.9	249	0.059	0.205	RU2A_ARATH U2 small nuclear ribonucleoprotein A' OS=Arabidopsis thaliana OX=3702 GN=At1g09760 PE=2 SV=2
15	C6S3E1	4.88e-10	63.9	309	0.059	0.165	C6S3E1_PLAF7 Protein phosphatase 1 regulatory subunit 7 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1032800 PE=3 SV=1
16	Q38BT2	6.63e-10	65.1	630	0.064	0.087	Q38BT2_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4360 PE=4 SV=1
17	Q7Z7A1	6.65e-10	65.9	2325	0.054	0.020	CNTRL_HUMAN Centriolin OS=Homo sapiens OX=9606 GN=CNTRL PE=1 SV=2
18	P45969	8.98e-10	63.5	326	0.062	0.166	SDS22_CAEEL Protein phosphatase 1 regulatory subunit SDS22 homolog OS=Caenorhabditis elegans OX=6239 GN=sds-22 PE=3 SV=1
19	A0A1L8G016	1.25e-09	63.9	469	0.059	0.109	DAA11_XENLA Dynein axonemal assembly factor 11 OS=Xenopus laevis OX=8355 GN=dnaaf11 PE=3 SV=1
20	Q5AHH6	1.28e-09	63.5	374	0.050	0.115	Q5AHH6_CANAL Type 1 protein phosphatase-activating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SDS22 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00612 IQ	12	17.0	IQ calmodulin-binding motif
2	PF00560 LRR_1	56	15.6	Leucine Rich Repeat
3	PF12799 LRR_4	3.9e-09	47.9	Leucine Rich repeats (2 copies)
4	PF13516 LRR_6	62	15.1	Leucine Rich repeat
5	PF13855 LRR_8	3e-08	44.6	Leucine rich repeat
6	PF14580 LRR_9	6.3e-16	69.9	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342510

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370803	0.999	Centriolar coiled-coil protein of 110 kDa
2	9606.ENSP00000448012	0.964	Centrosomal protein of 290 kDa
3	9606.ENSP00000368464	0.916	Kinesin-like protein KIF24
4	9606.ENSP00000382390	0.896	Neuralized-like protein 4
5	9606.ENSP00000262127	0.886	Centrosomal protein of 76 kDa
6	9606.ENSP00000270861	0.797	Serine/threonine-protein kinase PLK4
7	9606.ENSP00000367208	0.777	Protein SGT1 homolog
8	9606.ENSP00000287482	0.776	Spindle assembly abnormal protein 6 homolog
9	9606.ENSP00000316681	0.765	Centrosomal protein of 295 kDa
10	9606.ENSP00000278935	0.760	Centrosomal protein of 164 kDa
11	9606.ENSP00000371308	0.753	Centromere protein J
12	9606.ENSP00000367476	0.739	Centrosomal protein of 104 kDa
13	9606.ENSP00000267890	0.732	Tau-tubulin kinase 2
14	9606.ENSP00000377668	0.727	Sulfite oxidase, mitochondrial
15	9606.ENSP00000306105	0.716	Centrosomal protein of 89 kDa
16	9606.ENSP00000291295	0.704	Calmodulin 3 (phosphorylase kinase, delta)
17	9606.ENSP00000257287	0.700	Centrosomal protein of 135 kDa
18	9606.ENSP00000323580	0.697	Intraflagellar transport protein 88 homolog
19	9606.ENSP00000370337	0.685	Centrosomal protein of 152 kDa
20	9606.ENSP00000385215	0.683	Centrosomal protein of 162 kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:1902017	0.980	regulation of cilium assembly
GO:0010639	0.976	negative regulation of organelle organization
GO:0120033	0.971	negative regulation of plasma membrane bounded cell projection assembly
GO:1902116	0.968	negative regulation of organelle assembly
GO:0032886	0.944	regulation of microtubule-based process
GO:0070507	0.897	regulation of microtubule cytoskeleton organization
GO:0010564	0.890	regulation of cell cycle process
GO:0090224	0.828	regulation of spindle organization
GO:0060236	0.671	regulation of mitotic spindle organization
GO:0009987	0.615	cellular process
GO:0016043	0.347	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	1.000	centrosome
GO:0005829	0.997	cytosol
GO:0032991	0.988	protein-containing complex
GO:0005814	0.986	centriole
GO:0043227	0.736	membrane-bounded organelle
GO:0043231	0.599	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]