StarFunc result for job id Q8IW41

User Input

>input (473 residues)
MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKAR
NEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHF
TEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDL
MTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPP
FYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLD
HPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPIL
RKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQ
EAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54992	0.910	0.910	2.632E-72	473	0.966	0.966	O54992.pdb.gz	MAPK5_MOUSE MAP kinase-activated protein kinase 5 OS=Mus musculus OX=10090 GN=Mapkapk5 PE=1 SV=1
2	AFDB:Q7T2F2	0.636	0.781	2.408E-32	382	0.321	0.398	Q7T2F2.pdb.gz	Q7T2F2_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=mapkapk2 PE=1 SV=1
3	AFDB:P49137	0.630	0.740	1.895E-31	400	0.321	0.380	P49137.pdb.gz	MAPK2_HUMAN MAP kinase-activated protein kinase 2 OS=Homo sapiens OX=9606 GN=MAPKAPK2 PE=1 SV=1
4	AFDB:Q965G5	0.640	0.815	6.597E-31	366	0.317	0.410	Q965G5.pdb.gz	MAK2_CAEEL MAP kinase-activated protein kinase mak-2 OS=Caenorhabditis elegans OX=6239 GN=mak-2 PE=1 SV=2
5	AFDB:P49071	0.625	0.812	8.800E-29	359	0.300	0.396	P49071.pdb.gz	MAPK2_DROME MAP kinase-activated protein kinase 2 OS=Drosophila melanogaster OX=7227 GN=MAPk-Ak2 PE=2 SV=1
6	AFDB:Q3UMW7	0.627	0.765	9.232E-29	384	0.311	0.383	Q3UMW7.pdb.gz	MAPK3_MOUSE MAP kinase-activated protein kinase 3 OS=Mus musculus OX=10090 GN=Mapkapk3 PE=1 SV=2
7	PDB:6tcaA	0.589	0.797	1.417E-27	345	0.311	0.426	6tcaA.pdb.gz	MAP Kinase-Mediated Activation of RSK1 and MK2 Substrate Kinases.
8	AFDB:Q21360	0.607	0.554	8.395E-24	521	0.271	0.246	Q21360.pdb.gz	MAK1_CAEEL MAP kinase-activated protein kinase mak-1 OS=Caenorhabditis elegans OX=6239 GN=mak-1 PE=1 SV=1
9	AFDB:O75582	0.579	0.352	2.412E-23	802	0.262	0.155	O75582.pdb.gz	KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens OX=9606 GN=RPS6KA5 PE=1 SV=1
10	AFDB:Q9HBH9	0.533	0.542	9.242E-23	465	0.262	0.267	Q9HBH9.pdb.gz	MKNK2_HUMAN MAP kinase-interacting serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MKNK2 PE=1 SV=3
11	AFDB:Q8I113	0.549	0.377	2.300E-22	707	0.262	0.175	Q8I113.pdb.gz	MNK_CAEEL MAP kinase-interacting serine/threonine-protein kinase mnk-1 OS=Caenorhabditis elegans OX=6239 GN=mnk-1 PE=2 SV=2
12	PDB:5u6yA	0.477	0.490	2.914E-20	459	0.233	0.240	5u6yA.pdb.gz
13	PDB:3soaA	0.488	0.527	2.293E-19	436	0.224	0.243	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
14	PDB:2yaaA	0.515	0.794	1.064E-18	300	0.203	0.320	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
15	PDB:8bfsA	0.471	0.788	8.376E-18	274	0.205	0.354	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
16	PDB:4zhxA	0.456	0.524	1.290E-16	409	0.209	0.242	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
17	PDB:6b1uA	0.459	0.489	2.407E-16	442	0.218	0.233	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
18	PDB:4rerA	0.452	0.465	7.256E-16	459	0.207	0.214	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:7myjC	0.449	0.456	1.640E-15	465	0.211	0.215	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
20	PDB:6byrA	0.477	0.552	2.407E-15	405	0.207	0.242	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O54992	0.0	967	473	0.973	0.973	MAPK5_MOUSE MAP kinase-activated protein kinase 5 OS=Mus musculus OX=10090 GN=Mapkapk5 PE=1 SV=1
2	Q8IW41	0.0	988	473	1.000	1.000	MAPK5_HUMAN MAP kinase-activated protein kinase 5 OS=Homo sapiens OX=9606 GN=MAPKAPK5 PE=1 SV=2
3	R4GN33	0.0	657	324	0.660	0.963	R4GN33_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=MAPKAPK5 PE=1 SV=1
4	P49137	1.55e-90	283	400	0.323	0.383	MAPK2_HUMAN MAP kinase-activated protein kinase 2 OS=Homo sapiens OX=9606 GN=MAPKAPK2 PE=1 SV=1
5	P49138	1.72e-89	280	386	0.323	0.396	MAPK2_MOUSE MAP kinase-activated protein kinase 2 OS=Mus musculus OX=10090 GN=Mapkapk2 PE=1 SV=2
6	Q7T2F2	4.01e-88	276	382	0.323	0.401	Q7T2F2_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=mapkapk2 PE=1 SV=1
7	Q965G5	1.88e-87	274	366	0.317	0.410	MAK2_CAEEL MAP kinase-activated protein kinase mak-2 OS=Caenorhabditis elegans OX=6239 GN=mak-2 PE=1 SV=2
8	Q16644	5.70e-86	270	382	0.317	0.393	MAPK3_HUMAN MAP kinase-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPKAPK3 PE=1 SV=1
9	Q3UMW7	1.02e-84	267	384	0.315	0.388	MAPK3_MOUSE MAP kinase-activated protein kinase 3 OS=Mus musculus OX=10090 GN=Mapkapk3 PE=1 SV=2
10	P49071	1.17e-83	264	359	0.304	0.401	MAPK2_DROME MAP kinase-activated protein kinase 2 OS=Drosophila melanogaster OX=7227 GN=MAPk-Ak2 PE=2 SV=1
11	Q21360	2.00e-59	205	521	0.239	0.217	MAK1_CAEEL MAP kinase-activated protein kinase mak-1 OS=Caenorhabditis elegans OX=6239 GN=mak-1 PE=1 SV=1
12	O75582	2.91e-56	202	802	0.239	0.141	KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens OX=9606 GN=RPS6KA5 PE=1 SV=1
13	Q8ICR0	4.10e-56	196	513	0.245	0.226	CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=CDPK2 PE=1 SV=4
14	A4V110	6.95e-56	192	390	0.241	0.292	A4V110_DROME Calcium/calmodulin-dependent protein kinase I, isoform I OS=Drosophila melanogaster OX=7227 GN=CaMKI PE=1 SV=1
15	P25323	2.32e-55	188	295	0.239	0.383	MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum OX=44689 GN=mlkA PE=1 SV=2
16	A0A509AQE6	4.16e-54	192	562	0.216	0.181	CDPK5_PLABA Calcium-dependent protein kinase 5 OS=Plasmodium berghei (strain Anka) OX=5823 GN=CDPK5 PE=1 SV=1
17	Q7JMV3	8.10e-54	187	405	0.243	0.284	Q7JMV3_DROME Calcium/calmodulin dependent protein kinase I OS=Drosophila melanogaster OX=7227 GN=CaMKI PE=1 SV=1
18	W0LYS5	1.76e-52	182	345	0.222	0.304	CAMKI_MACNP Calcium/calmodulin-dependent protein kinase type 1 OS=Macrobrachium nipponense OX=159736 GN=CaMKI PE=2 SV=1
19	A2A124	2.16e-52	190	722	0.243	0.159	A2A124_DANRE Doublecortin like protein kinase_4 OS=Danio rerio OX=7955 GN=cb572 PE=1 SV=1
20	A0A5K1K8H0	2.47e-52	187	568	0.224	0.187	CDPK5_PLAF7 Calcium-dependent protein kinase 5 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=CDPK5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	6.6e+02	11.5	Phosphotransferase enzyme family
2	PF06293 Kdo	0.0041	28.1	Lipopolysaccharide kinase (Kdo/WaaP) family
3	PF14531 Kinase-like	5.8	17.7	Kinase-like
4	PF00069 Pkinase	1.9e-58	209.5	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	1.6e-18	78.5	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000449381

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000248553	0.992	Heat shock protein beta-1
2	9606.ENSP00000261845	0.986	Mitogen-activated protein kinase 6
3	9606.ENSP00000229795	0.960	Mitogen-activated protein kinase 14
4	9606.ENSP00000333685	0.958	Mitogen-activated protein kinase 11
5	9606.ENSP00000269305	0.949	Cellular tumor antigen p53
6	9606.ENSP00000479618	0.939	Myc proto-oncogene protein
7	9606.ENSP00000383234	0.925	Mitogen-activated protein kinase 4
8	9606.ENSP00000468348	0.924	Dual specificity mitogen-activated protein kinase kinase 6
9	9606.ENSP00000385824	0.923	Forkhead box protein O3
10	9606.ENSP00000345083	0.921	Dual specificity mitogen-activated protein kinase kinase 3
11	9606.ENSP00000215659	0.913	Mitogen-activated protein kinase 12
12	9606.ENSP00000368880	0.911	Forkhead box protein O1
13	9606.ENSP00000366488	0.909	cAMP-dependent protein kinase catalytic subunit gamma
14	9606.ENSP00000309591	0.906	cAMP-dependent protein kinase catalytic subunit alpha
15	9606.ENSP00000359719	0.906	cAMP-dependent protein kinase catalytic subunit beta
16	9606.ENSP00000279249	0.902	Cdc42 effector protein 2
17	9606.ENSP00000295324	0.900	Cdc42 effector protein 3
18	9606.ENSP00000301200	0.900	Cdc42 effector protein 5
19	9606.ENSP00000211287	0.899	Mitogen-activated protein kinase 13
20	9606.ENSP00000254322	0.815	DnaJ homolog subfamily B member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0002039	1.000	p53 binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.616	enzyme binding
GO:0019901	0.339	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.988	response to stimulus
GO:0044237	0.981	cellular metabolic process
GO:0050794	0.977	regulation of cellular process
GO:0071704	0.970	organic substance metabolic process
GO:0051716	0.968	cellular response to stimulus
GO:0044238	0.966	primary metabolic process
GO:0019222	0.962	regulation of metabolic process
GO:0006807	0.936	nitrogen compound metabolic process
GO:0016310	0.936	phosphorylation
GO:0043170	0.935	macromolecule metabolic process
GO:0006468	0.934	protein phosphorylation
GO:0060255	0.912	regulation of macromolecule metabolic process
GO:0048522	0.889	positive regulation of cellular process
GO:0006950	0.887	response to stress
GO:0090398	0.858	cellular senescence
GO:0032204	0.829	regulation of telomere maintenance
GO:1902531	0.809	regulation of intracellular signal transduction
GO:0009891	0.805	positive regulation of biosynthetic process
GO:0010468	0.767	regulation of gene expression
GO:0031325	0.763	positive regulation of cellular metabolic process
GO:1904356	0.755	regulation of telomere maintenance via telomere lengthening
GO:0031328	0.735	positive regulation of cellular biosynthetic process
GO:0007165	0.727	signal transduction
GO:0048523	0.722	negative regulation of cellular process
GO:2000278	0.719	regulation of DNA biosynthetic process
GO:0010604	0.711	positive regulation of macromolecule metabolic process
GO:0065009	0.699	regulation of molecular function
GO:0035556	0.698	intracellular signal transduction
GO:0051173	0.683	positive regulation of nitrogen compound metabolic process
GO:0032210	0.679	regulation of telomere maintenance via telomerase
GO:2001252	0.468	positive regulation of chromosome organization
GO:0045935	0.467	positive regulation of nucleobase-containing compound metabolic process
GO:0007264	0.441	small GTPase mediated signal transduction
GO:0050793	0.384	regulation of developmental process
GO:0050790	0.304	regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005829	0.996	cytosol
GO:0043232	0.779	intracellular non-membrane-bounded organelle
GO:0032991	0.696	protein-containing complex
GO:0005856	0.367	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]