StarFunc result for job id Q8IW45

User Input

>input (347 residues)
MVTRAGAGTAVAGAVVVALLSAALALYGPPLDAVLERAFSLRKAHSIKDMENTLQLVRNI
IPPLSSTKHKGQDGRIGVVGGCQEYTGAPYFAAISALKVGADLSHVFCASAAAPVIKAYS
PELIVHPVLDSPNAVHEVEKWLPRLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVI
DADGLWLVAQQPALIHGYRKAVLTPNHVEFSRLYDAVLRGPMDSDDSHGSVLRLSQALGN
VTVVQKGERDILSNGQQVLVCSQEGSSRRCGGQGDLLSGSLGVLVHWALLAGPQKTNGSS
PLLVAAFGACSLTRQCNHQAFQKHGRSTTTSDMIAEVGAAFSKLFET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IW45	1.000	1.000	5.135E-58	347	1.000	1.000	Q8IW45.pdb.gz	NNRD_HUMAN ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Homo sapiens OX=9606 GN=NAXD PE=1 SV=1
2	AFDB:D4AAT7	0.907	0.917	8.693E-49	343	0.784	0.793	D4AAT7.pdb.gz	NNRD_RAT ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Rattus norvegicus OX=10116 GN=Naxd PE=3 SV=1
3	AFDB:Q94AF2	0.813	0.773	2.034E-32	365	0.429	0.408	Q94AF2.pdb.gz	NNRD_ARATH ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Arabidopsis thaliana OX=3702 GN=At5g19150 PE=1 SV=1
4	AFDB:O94347	0.791	0.838	1.797E-28	327	0.380	0.404	O94347.pdb.gz	NNRD_SCHPO ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC61.03 PE=3 SV=1
5	AFDB:P36059	0.772	0.794	3.753E-25	337	0.334	0.344	P36059.pdb.gz	NNRD_YEAST ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NNR2 PE=1 SV=1
6	AFDB:P31806	0.675	0.464	1.584E-15	515	0.207	0.140	P31806.pdb.gz	NNR_ECOLI Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Escherichia coli (strain K12) OX=83333 GN=nnr PE=1 SV=2
7	AFDB:P76423	0.565	0.724	4.934E-9	262	0.124	0.164	P76423.pdb.gz	THIM_ECOLI Hydroxyethylthiazole kinase OS=Escherichia coli (strain K12) OX=83333 GN=thiM PE=1 SV=1
8	AFDB:Q9LIQ4	0.582	0.715	3.899E-8	276	0.138	0.174	Q9LIQ4.pdb.gz	THIM_ARATH Hydroxyethylthiazole kinase OS=Arabidopsis thaliana OX=3702 GN=THIM PE=1 SV=1
9	AFDB:K7VCB9	0.569	0.689	6.306E-8	280	0.118	0.146	K7VCB9.pdb.gz	THIM_MAIZE Hydroxyethylthiazole kinase OS=Zea mays OX=4577 GN=THIM PE=1 SV=1
10	AFDB:P40386	0.539	0.375	4.527E-7	518	0.138	0.093	P40386.pdb.gz	THI6_SCHPO Probable thiamine biosynthetic bifunctional enzyme OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=thi4 PE=2 SV=1
11	PDB:2ddmB	0.462	0.568	3.092E-6	271	0.147	0.188	2ddmB.pdb.gz
12	PDB:7vtdA	0.438	0.484	7.346E-6	307	0.112	0.127	7vtdA.pdb.gz
13	PDB:1gqtB	0.471	0.524	7.707E-6	307	0.135	0.153	1gqtB.pdb.gz	Activation of Ribokinase by Monovalent Cations.
14	PDB:3rm5A	0.452	0.314	1.831E-5	521	0.112	0.075	3rm5A.pdb.gz
15	PDB:3nl2C	0.487	0.353	4.351E-5	498	0.115	0.080	3nl2C.pdb.gz
16	PDB:3nl6A	0.492	0.348	5.533E-5	518	0.098	0.066	3nl6A.pdb.gz	Domain Organization in Candida glabrata THI6, a Bifunctional Enzyme Required for Thiamin Biosynthesis in Eukaryotes .
17	PDB:7c1yA	0.448	0.439	6.391E-5	356	0.101	0.098	7c1yA.pdb.gz	Structural basis for the substrate specificity and catalytic features of pseudouridine kinase from Arabidopsis thaliana.
18	PDB:3in1A	0.452	0.493	9.389E-5	312	0.121	0.135	3in1A.pdb.gz	Crystal structure of a putative Ribokinase in complex with ADP from E.coli
19	PDB:1vi9A	0.461	0.540	1.754E-4	288	0.110	0.132	1vi9A.pdb.gz
20	PDB:5bycA	0.475	0.512	2.704E-4	318	0.098	0.107	5bycA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4AAT7	0.0	569	343	0.781	0.790	NNRD_RAT ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Rattus norvegicus OX=10116 GN=Naxd PE=3 SV=1
2	Q8IW45	0.0	703	347	1.000	1.000	NNRD_HUMAN ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Homo sapiens OX=9606 GN=NAXD PE=1 SV=1
3	Q9CZ42	0.0	556	343	0.761	0.770	NNRD_MOUSE ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Mus musculus OX=10090 GN=Naxd PE=1 SV=1
4	Q94AF2	1.88e-90	277	365	0.409	0.389	NNRD_ARATH ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Arabidopsis thaliana OX=3702 GN=At5g19150 PE=1 SV=1
5	O94347	9.55e-88	269	327	0.401	0.425	NNRD_SCHPO ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC61.03 PE=3 SV=1
6	P36059	1.24e-63	207	337	0.354	0.365	NNRD_YEAST ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NNR2 PE=1 SV=1
7	P31806	2.45e-14	76.3	515	0.199	0.134	NNR_ECOLI Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Escherichia coli (strain K12) OX=83333 GN=nnr PE=1 SV=2
8	Q9FID9	0.062	37.7	880	0.084	0.033	Y5389_ARATH Probable receptor-like protein kinase At5g38990 OS=Arabidopsis thaliana OX=3702 GN=At5g38990 PE=2 SV=1
9	Q9HU83	7.9	30.8	559	0.046	0.029	HUTU_PSEAE Urocanate hydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=hutU PE=1 SV=1
10	P10073	8.5	30.8	491	0.040	0.029	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
11	Q9ZV85	8.9	30.4	352	0.124	0.122	GGH3_ARATH Probable gamma-glutamyl hydrolase 3 OS=Arabidopsis thaliana OX=3702 GN=GGH3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01256 Carb_kinase	3.1e-54	195.6	Carbohydrate kinase
2	PF02875 Mur_ligase_C	4.6e+02	12.5	Mur ligase family, glutamate ligase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000010969

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000000743	0.985	NAD(P)H-hydrate epimerase
2	9593.ENSGGOP00000005857	0.921	YjeF N-terminal domain containing 3
3	9593.ENSGGOP00000003490	0.873	Enhancer of mRNA decapping 3
4	9593.ENSGGOP00000000854	0.781	TBC/LysM-associated domain containing 1
5	9593.ENSGGOP00000003645	0.752	Glyoxylate reductase/hydroxypyruvate reductase
6	9593.ENSGGOP00000016255	0.744	Sphingosine-1-phosphate lyase 1
7	9593.ENSGGOP00000023693	0.709	Ubiquitin-conjugating enzyme E2C
8	9593.ENSGGOP00000005469	0.648	M-phase phosphoprotein 9
9	9593.ENSGGOP00000003720	0.643	Pyridoxamine 5'-phosphate oxidase
10	9593.ENSGGOP00000012765	0.640	Uncharacterized protein
11	9593.ENSGGOP00000021145	0.640	CDKN2A interacting protein N-terminal like
12	9593.ENSGGOP00000023422	0.640	CDKN2A interacting protein
13	9593.ENSGGOP00000007346	0.616	DNA replication and sister chromatid cohesion 1
14	9593.ENSGGOP00000000589	0.602	Isochorismatase domain containing 2
15	9593.ENSGGOP00000012460	0.602	Isochorismatase domain containing 1
16	9593.ENSGGOP00000002674	0.573	Zinc finger, HIT-type containing 2
17	9593.ENSGGOP00000011563	0.572	Transmembrane protein 39A
18	9593.ENSGGOP00000002343	0.570	HGH1 homolog (S. cerevisiae)
19	9593.ENSGGOP00000013293	0.533	Papillary renal cell carcinoma (translocation-associated)
20	9593.ENSGGOP00000001573	0.531	GID complex subunit 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047453	1.000	ATP-dependent NAD(P)H-hydrate dehydratase activity
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0008152	0.976	metabolic process
GO:0072524	0.968	pyridine-containing compound metabolic process
GO:0046496	0.955	nicotinamide nucleotide metabolic process
GO:1901566	0.943	organonitrogen compound biosynthetic process
GO:0044249	0.941	cellular biosynthetic process
GO:0044271	0.929	cellular nitrogen compound biosynthetic process
GO:0006163	0.926	purine nucleotide metabolic process
GO:0006164	0.922	purine nucleotide biosynthetic process
GO:0019674	0.894	NAD metabolic process
GO:0072525	0.835	pyridine-containing compound biosynthetic process
GO:0019363	0.748	pyridine nucleotide biosynthetic process
GO:0009435	0.741	NAD biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.996	intracellular organelle lumen
GO:0005759	0.682	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19017	1.000	(6S)-NADHX + ATP = ADP + H(+) + NADH + phosphate
EC:4.2.1.93	1.000	ATP-dependent NAD(P)H-hydrate dehydratase.

[back to server]