StarFunc result for job id Q8IWA5

User Input

>input (706 residues)
MGDERPHYYGKHGTPQKYDPTFKGPIYNRGCTDIICCVFLLLAIVGYVAVGIIAWTHGDP
RKVIYPTDSRGEFCGQKGTKNENKPYLFYFNIVKCASPLVLLEFQCPTPQICVEKCPDRY
LTYLNARSSRDFEYYKQFCVPGFKNNKGVAEVLQDGDCPAVLIPSKPLARRCFPAIHAYK
GVLMVGNETTYEDGHGSRKNITDLVEGAKKANGVLEARQLAMRIFEDYTVSWYWIIIGLV
IAMAMSLLFIILLRFLAGIMVWVMIIMVILVLGYGIFHCYMEYSRLRGEAGSDVSLVDLG
FQTDFRVYLHLRQTWLAFMIILSILEVIIILLLIFLRKRILIAIALIKEASRAVGYVMCS
LLYPLVTFFLLCLCIAYWASTAVFLSTSNEAVYKIFDDSPCPFTAKTCNPETFPSSNESR
QCPNARCQFAFYGGESGYHRALLGLQIFNAFMFFWLANFVLALGQVTLAGAFASYYWALR
KPDDLPAFPLFSAFGRALRYHTGSLAFGALILAIVQIIRVILEYLDQRLKAAENKFAKCL
MTCLKCCFWCLEKFIKFLNRNAYIMIAIYGTNFCTSARNAFFLLMRNIIRVAVLDKVTDF
LFLLGKLLIVGSVGILAFFFFTHRIRIVQDTAPPLNYYWVPILTVIVGSYLIAHGFFSVY
GMCVDTLFLCFLEDLERNDGSAERPYFMSSTLKKLLNKTNKKAAES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BY89	0.992	0.992	1.474E-98	706	0.909	0.909	Q8BY89.pdb.gz	CTL2_MOUSE Choline transporter-like protein 2 OS=Mus musculus OX=10090 GN=Slc44a2 PE=1 SV=2
2	AFDB:Q8NCS7	0.948	0.932	3.132E-74	719	0.544	0.534	Q8NCS7.pdb.gz	CTL5_HUMAN Choline transporter-like protein 5 OS=Homo sapiens OX=9606 GN=SLC44A5 PE=1 SV=5
3	AFDB:Q7T2B0	0.891	0.871	1.057E-65	723	0.524	0.512	Q7T2B0.pdb.gz	CTL4_DANRE Choline transporter-like protein 4 OS=Danio rerio OX=7955 GN=slc44a4 PE=2 SV=1
4	AFDB:Q91VA1	0.892	0.891	9.705E-65	707	0.521	0.521	Q91VA1.pdb.gz	CTL4_MOUSE Choline transporter-like protein 4 OS=Mus musculus OX=10090 GN=Slc44a4 PE=1 SV=1
5	AFDB:Q53GD3	0.862	0.858	1.670E-64	710	0.523	0.520	Q53GD3.pdb.gz	CTL4_HUMAN Choline transporter-like protein 4 OS=Homo sapiens OX=9606 GN=SLC44A4 PE=1 SV=2
6	AFDB:A0A024R151	0.665	0.710	4.210E-33	657	0.258	0.277	A0A024R151.pdb.gz
7	AFDB:F1Q9M4	0.657	0.706	4.871E-31	651	0.262	0.284	F1Q9M4.pdb.gz	F1Q9M4_DANRE Choline transporter-like protein OS=Danio rerio OX=7955 GN=slc44a1a PE=1 SV=2
8	AFDB:Q8N4M1	0.522	0.560	4.539E-27	653	0.255	0.276	Q8N4M1.pdb.gz	CTL3_HUMAN Choline transporter-like protein 3 OS=Homo sapiens OX=9606 GN=SLC44A3 PE=1 SV=4
9	AFDB:Q94AN2	0.582	0.586	5.955E-27	700	0.231	0.233	Q94AN2.pdb.gz	CHER1_ARATH Choline transporter protein 1 OS=Arabidopsis thaliana OX=3702 GN=CHER1 PE=1 SV=1
10	AFDB:Q38CI7	0.649	0.665	1.186E-24	688	0.214	0.219	Q38CI7.pdb.gz	Q38CI7_TRYB2 Choline transporter-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7750 PE=3 SV=1
11	PDB:7wwbA	0.383	0.790	1.312E-13	333	0.169	0.357	7wwbA.pdb.gz	Rational exploration of fold atlas for human solute carrier proteins.
12	PDB:7w72U	0.086	0.126	1.670E-1	420	0.069	0.117	7w72U.pdb.gz	Structure of human glycosylphosphatidylinositol transamidase.
13	PDB:5yqzR	0.084	0.098	3.007E-1	558	0.091	0.115	5yqzR.pdb.gz	Structure of the glucagon receptor in complex with a glucagon analogue.
14	PDB:6w8nA	0.060	0.088	3.444E-1	402	0.064	0.112	6w8nA.pdb.gz
15	PDB:7vfsA	0.072	0.053	3.444E-1	1266	0.103	0.058	7vfsA.pdb.gz	Closed-state inactivation and pore-blocker modulation mechanisms of human Ca V 2.2.
16	PDB:5lzqA	0.087	0.086	3.604E-1	725	0.064	0.062	5lzqA.pdb.gz	Membrane pyrophosphatases from Thermotoga maritima and Vigna radiata suggest a conserved coupling mechanism.
17	PDB:7f53R	0.084	0.150	3.604E-1	273	0.057	0.147	7f53R.pdb.gz	Structural insights into ligand recognition and activation of the melanocortin-4 receptor.
18	PDB:4c6gB	0.076	0.083	3.945E-1	626	0.079	0.089	4c6gB.pdb.gz
19	PDB:7oy2C	0.084	0.111	4.128E-1	454	0.093	0.145	7oy2C.pdb.gz	Mechanistic and structural diversity between cytochrome bd isoforms of Escherichia coli .
20	PDB:6wpwR	0.096	0.140	5.415E-1	398	0.065	0.116	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53GD3	0.0	681	710	0.531	0.528	CTL4_HUMAN Choline transporter-like protein 4 OS=Homo sapiens OX=9606 GN=SLC44A4 PE=1 SV=2
2	Q7T2B0	0.0	743	723	0.535	0.523	CTL4_DANRE Choline transporter-like protein 4 OS=Danio rerio OX=7955 GN=slc44a4 PE=2 SV=1
3	Q8BY89	0.0	1319	706	0.909	0.909	CTL2_MOUSE Choline transporter-like protein 2 OS=Mus musculus OX=10090 GN=Slc44a2 PE=1 SV=2
4	Q8IWA5	0.0	1450	706	1.000	1.000	CTL2_HUMAN Choline transporter-like protein 2 OS=Homo sapiens OX=9606 GN=SLC44A2 PE=1 SV=3
5	Q8NCS7	0.0	833	719	0.547	0.537	CTL5_HUMAN Choline transporter-like protein 5 OS=Homo sapiens OX=9606 GN=SLC44A5 PE=1 SV=5
6	Q91VA1	0.0	666	707	0.524	0.523	CTL4_MOUSE Choline transporter-like protein 4 OS=Mus musculus OX=10090 GN=Slc44a4 PE=1 SV=1
7	Q8WWI5	1.07e-79	269	657	0.286	0.307	CTL1_HUMAN Choline transporter-like protein 1 OS=Homo sapiens OX=9606 GN=SLC44A1 PE=1 SV=1
8	Q6X893	1.26e-79	269	653	0.279	0.302	CTL1_MOUSE Choline transporter-like protein 1 OS=Mus musculus OX=10090 GN=Slc44a1 PE=1 SV=3
9	Q8VII6	2.57e-79	268	656	0.279	0.300	CTL1_RAT Choline transporter-like protein 1 OS=Rattus norvegicus OX=10116 GN=Slc44a1 PE=1 SV=1
10	F1Q9M4	7.50e-68	237	651	0.280	0.304	F1Q9M4_DANRE Choline transporter-like protein OS=Danio rerio OX=7955 GN=slc44a1a PE=1 SV=2
11	Q8N4M1	5.94e-62	221	653	0.276	0.299	CTL3_HUMAN Choline transporter-like protein 3 OS=Homo sapiens OX=9606 GN=SLC44A3 PE=1 SV=4
12	Q94AN2	2.50e-54	200	700	0.258	0.260	CHER1_ARATH Choline transporter protein 1 OS=Arabidopsis thaliana OX=3702 GN=CHER1 PE=1 SV=1
13	Q38CI7	5.61e-38	152	688	0.272	0.279	Q38CI7_TRYB2 Choline transporter-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7750 PE=3 SV=1
14	Q38AT4	2.30e-15	81.6	489	0.096	0.139	Q38AT4_TRYB2 Choline transporter-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0040 PE=3 SV=1
15	Q38AT1	1.63e-14	79.0	505	0.133	0.186	Q38AT1_TRYB2 Choline transporter-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.4010 PE=3 SV=1
16	Q38AT3	2.36e-13	75.5	490	0.092	0.133	Q38AT3_TRYB2 Choline transporter-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0010 PE=3 SV=1
17	Q12412	1.82e-11	69.7	539	0.061	0.080	PNS1_YEAST Protein PNS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PNS1 PE=1 SV=1
18	Q9W2I5	1.9	34.3	1312	0.058	0.031	Q9W2I5_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10505 PE=4 SV=2
19	Q92903	2.1	33.9	461	0.044	0.067	CDS1_HUMAN Phosphatidate cytidylyltransferase 1 OS=Homo sapiens OX=9606 GN=CDS1 PE=1 SV=2
20	Q9ZP16	2.5	33.9	667	0.023	0.024	CRK11_ARATH Cysteine-rich receptor-like protein kinase 11 OS=Arabidopsis thaliana OX=3702 GN=CRK11 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04515 Choline_transpo	3.8e-106	366.7	Plasma-membrane choline transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000336888

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379862	0.731	Cochlin
2	9606.ENSP00000171111	0.727	Kelch-like ECH-associated protein 1
3	9606.ENSP00000362387	0.691	Tetraspanin-15
4	9606.ENSP00000264047	0.677	High affinity choline transporter 1
5	9606.ENSP00000377224	0.650	Cyclin-dependent kinase 4 inhibitor D
6	9606.ENSP00000261405	0.597	Von Willebrand factor
7	9606.ENSP00000377051	0.578	Ankyrin repeat domain-containing protein 42
8	9606.ENSP00000361087	0.553	Gamma-synuclein
9	9606.ENSP00000349252	0.529	Integrin alpha-L
10	9606.ENSP00000297578	0.507	Mitochondrial folate transporter/carrier

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0015220	0.999	choline transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0071704	0.978	organic substance metabolic process
GO:0071702	0.978	organic substance transport
GO:0044238	0.967	primary metabolic process
GO:0044237	0.967	cellular metabolic process
GO:0006807	0.960	nitrogen compound metabolic process
GO:0055085	0.956	transmembrane transport
GO:0015697	0.939	quaternary ammonium group transport
GO:1901576	0.935	organic substance biosynthetic process
GO:0044249	0.935	cellular biosynthetic process
GO:0065007	0.932	biological regulation
GO:1901564	0.903	organonitrogen compound metabolic process
GO:0050789	0.879	regulation of biological process
GO:0006650	0.847	glycerophospholipid metabolic process
GO:0046470	0.811	phosphatidylcholine metabolic process
GO:0015695	0.799	organic cation transport
GO:0045017	0.798	glycerolipid biosynthetic process
GO:0008654	0.795	phospholipid biosynthetic process
GO:1901566	0.788	organonitrogen compound biosynthetic process
GO:0046474	0.729	glycerophospholipid biosynthetic process
GO:0050794	0.703	regulation of cellular process
GO:0048518	0.654	positive regulation of biological process
GO:0048522	0.579	positive regulation of cellular process
GO:0006656	0.395	phosphatidylcholine biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0012505	0.996	endomembrane system
GO:0005737	0.995	cytoplasm
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005576	0.991	extracellular region
GO:0031982	0.986	vesicle
GO:0043230	0.981	extracellular organelle
GO:0005615	0.975	extracellular space
GO:0070062	0.972	extracellular exosome
GO:0031090	0.964	organelle membrane
GO:0031410	0.919	cytoplasmic vesicle
GO:0098588	0.863	bounding membrane of organelle
GO:0099503	0.817	secretory vesicle
GO:0005739	0.711	mitochondrion
GO:0030659	0.490	cytoplasmic vesicle membrane
GO:0000323	0.470	lytic vacuole
GO:0005764	0.457	lysosome
GO:0030667	0.443	secretory granule membrane
GO:0070013	0.328	intracellular organelle lumen
GO:0042581	0.307	specific granule
GO:0035579	0.304	specific granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]