StarFunc result for job id Q8IWB1

User Input

>input (547 residues)
MAMGLFRVCLVVVTAIINHPLLFPRENATVPENEEEIIRKMQAHQEKLQLEQLRLEEEVA
RLAAEKEALEQVAEEGRQQNETRVAWDLWSTLCMILFLMIEVWRQDHQEGPSPECLGGEE
DELPGLGGAPLQGLTLPNKATLGHFYERCIRGATADAARTREFLEGFVDDLLEALRSLCN
RDTDMEVEDFIGVDSMYENWQVDRPLLCHLFVPFTPPEPYRFHPELWCSGRSVPLDRQGY
GQIKVVRADGDTLSCICGKTKLGEDMLCLLHGRNSMAPPCGDMENLLCATDSLYLDTMQV
MKWFQTALTRAWKGIAHKYEFDLAFGQLDSPGSLKIKFRSGKFMPFNLIPVIQCDDSDLY
FVSHLPREPSEGTPASSTDWLLSFAVYERHFLRTTLKALPEGACHLSCLQIASFLLSKQS
RLTGPSGLSSYHLKTALLHLLLLRQAADWKAGQLDARLHELLCFLEKSLLQKKLHHFFIG
NRKVPEAMGLPEAVLRAEPLNLFRPFVLQRSLYRKTLDSFYEMLKNAPALISEYSLHVPS
DQPTPKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IWB1	1.000	1.000	4.068E-91	547	1.000	1.000	Q8IWB1.pdb.gz	IPRI_HUMAN Inositol 1,4,5-trisphosphate receptor-interacting protein OS=Homo sapiens OX=9606 GN=ITPRIP PE=1 SV=1
2	AFDB:Q3TNL8	0.787	0.776	2.062E-73	555	0.782	0.771	Q3TNL8.pdb.gz	IPRI_MOUSE Inositol 1,4,5-trisphosphate receptor-interacting protein OS=Mus musculus OX=10090 GN=Itprip PE=1 SV=1
3	AFDB:Q6GPH6	0.626	0.618	6.447E-35	555	0.303	0.299	Q6GPH6.pdb.gz	IPIL1_HUMAN Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 OS=Homo sapiens OX=9606 GN=ITPRIPL1 PE=1 SV=1
4	PDB:7buqA	0.498	0.726	4.076E-12	362	0.115	0.174	7buqA.pdb.gz	Mn2+Directly Activates cGAS and Structural Analysis Suggests Mn2+Induces a Noncanonical Catalytic Synthesis of 2'3'-cGAMP.
5	PDB:7lt2A	0.466	0.633	6.238E-11	387	0.110	0.155	7lt2A.pdb.gz	cGAS-like receptors sense RNA and control 3'2'-cGAMP signalling in Drosophila.
6	PDB:5eomC	0.410	0.589	1.369E-9	353	0.132	0.204	5eomC.pdb.gz	Structural and biochemical characterization of the cell fate determining nucleotidyltransferase fold protein MAB21L1.
7	PDB:5eogF	0.364	0.548	2.963E-9	330	0.135	0.224	5eogF.pdb.gz
8	PDB:7lt1A	0.366	0.479	3.505E-8	403	0.121	0.164	7lt1A.pdb.gz
9	PDB:4rwnA	0.310	0.451	5.514E-5	349	0.079	0.123	4rwnA.pdb.gz	The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
10	PDB:5eomJ	0.332	0.582	8.763E-5	286	0.119	0.227	5eomJ.pdb.gz	Structural and biochemical characterization of the cell fate determining nucleotidyltransferase fold protein MAB21L1.
11	PDB:4txzB	0.318	0.447	4.790E-4	366	0.082	0.123	4txzB.pdb.gz	Structure-Guided Reprogramming of Human cGAS Dinucleotide Linkage Specificity.
12	PDB:6e0nA	0.328	0.599	8.015E-4	271	0.055	0.111	6e0nA.pdb.gz	Bacterial cGAS-like enzymes synthesize diverse nucleotide signals.
13	PDB:2q0eA	0.305	0.453	1.037E-3	331	0.088	0.145	2q0eA.pdb.gz	Dual role of the RNA substrate in selectivity and catalysis by terminal uridylyl transferases.
14	AFDB:P93286	0.059	0.069	1.553	442	0.102	0.127	P93286.pdb.gz	CCMFC_ARATH Cytochrome c biogenesis CcmF C-terminal-like mitochondrial protein OS=Arabidopsis thaliana OX=3702 GN=CCMFC PE=1 SV=3
15	AFDB:A0A0G2JZW4	0.121	0.039	1.721	2308	0.137	0.032	A0A0G2JZW4.pdb.gz	A0A0G2JZW4_RAT APC regulator of WNT signaling pathway 2 OS=Rattus norvegicus OX=10116 GN=Apc2 PE=3 SV=2
16	AFDB:Q0DAJ3	0.087	0.115	5.622	396	0.091	0.126	Q0DAJ3.pdb.gz	WRK28_ORYSJ WRKY transcription factor WRKY28 OS=Oryza sativa subsp. japonica OX=39947 GN=WRKY28 PE=2 SV=2
17	AFDB:Q8IK35	0.098	0.139	5.919	345	0.049	0.078	Q8IK35.pdb.gz	Q8IK35_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1000300 PE=4 SV=1
18	AFDB:Q9LXU9	0.110	0.107	6.908	562	0.051	0.050	Q9LXU9.pdb.gz	IRKI_ARATH IRK-interacting protein OS=Arabidopsis thaliana OX=3702 GN=IRKI PE=1 SV=1
19	AFDB:Q9LKB9	0.114	0.056	8.061	1505	0.119	0.043	Q9LKB9.pdb.gz	MYO6_ARATH Myosin-6 OS=Arabidopsis thaliana OX=3702 GN=XI-2 PE=1 SV=1
20	AFDB:P53894	0.085	0.064	8.487	756	0.126	0.091	P53894.pdb.gz	CBK1_YEAST Serine/threonine-protein kinase CBK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CBK1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TNL8	0.0	827	555	0.779	0.768	IPRI_MOUSE Inositol 1,4,5-trisphosphate receptor-interacting protein OS=Mus musculus OX=10090 GN=Itprip PE=1 SV=1
2	Q8IWB1	0.0	1128	547	1.000	1.000	IPRI_HUMAN Inositol 1,4,5-trisphosphate receptor-interacting protein OS=Homo sapiens OX=9606 GN=ITPRIP PE=1 SV=1
3	Q6GPH6	4.53e-63	218	555	0.302	0.297	IPIL1_HUMAN Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 OS=Homo sapiens OX=9606 GN=ITPRIPL1 PE=1 SV=1
4	A7SFB5	3.35e-06	52.0	422	0.104	0.135	CGAS_NEMVE Cyclic GMP-AMP synthase OS=Nematostella vectensis OX=45351 GN=v1g211400 PE=1 SV=1
5	Q8C6L5	5.57e-06	51.6	507	0.060	0.065	CGAS_MOUSE Cyclic GMP-AMP synthase OS=Mus musculus OX=10090 GN=Cgas PE=1 SV=1
6	Q8N884	3.72e-04	45.4	522	0.062	0.065	CGAS_HUMAN Cyclic GMP-AMP synthase OS=Homo sapiens OX=9606 GN=CGAS PE=1 SV=2
7	Q8BPP1	0.019	40.0	359	0.059	0.089	MB212_MOUSE Protein mab-21-like 2 OS=Mus musculus OX=10090 GN=Mab21l2 PE=2 SV=1
8	Q9Y586	0.022	39.7	359	0.059	0.089	MB212_HUMAN Protein mab-21-like 2 OS=Homo sapiens OX=9606 GN=MAB21L2 PE=1 SV=1
9	Q8UUZ1	0.027	39.3	359	0.059	0.089	MB212_DANRE Protein mab-21-like 2 OS=Danio rerio OX=7955 GN=mab21l2 PE=1 SV=1
10	O70299	0.075	38.1	359	0.059	0.089	MB211_MOUSE Putative nucleotidyltransferase MAB21L1 OS=Mus musculus OX=10090 GN=Mab21l1 PE=2 SV=1
11	Q13394	0.075	38.1	359	0.059	0.089	MB211_HUMAN Putative nucleotidyltransferase MAB21L1 OS=Homo sapiens OX=9606 GN=MAB21L1 PE=1 SV=1
12	Q8IDX6	0.89	35.0	3130	0.038	0.007	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
13	Q8L9S7	1.8	32.7	180	0.029	0.089	Q8L9S7_ARATH RAB6-interacting golgin OS=Arabidopsis thaliana OX=3702 GN=At3g52920 PE=1 SV=1
14	Q8SWR3	2.0	33.5	435	0.026	0.032	SPR_DROME Sex peptide receptor OS=Drosophila melanogaster OX=7227 GN=SPR PE=1 SV=1
15	Q7ZUS9	2.1	33.5	333	0.038	0.063	Q7ZUS9_DANRE Electron transfer flavoprotein subunit alpha OS=Danio rerio OX=7955 GN=wu:fd06h11 PE=1 SV=1
16	G4SLH0	4.3	32.7	18562	0.037	0.001	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2
17	C0H5F4	5.5	32.3	3254	0.031	0.005	RH2B_PLAF7 Reticulocyte-binding protein homolog 2b OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2b PE=1 SV=2
18	Q61079	5.6	32.3	657	0.040	0.033	SIM2_MOUSE Single-minded homolog 2 OS=Mus musculus OX=10090 GN=Sim2 PE=1 SV=1
19	Q8R4H2	6.0	32.3	1543	0.038	0.014	ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus musculus OX=10090 GN=Arhgef12 PE=1 SV=2
20	Q9VSH0	6.3	32.0	346	0.080	0.127	CGASL_DROME Cyclic GMP-AMP synthase-like protein OS=Drosophila melanogaster OX=7227 GN=CG7194 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04977 DivIC	24	16.1	Septum formation initiator
2	PF17371 DUF5393	4.4e+02	10.1	Family of unknown function (DUF5393)
3	PF20266 Mab-21_C	5e-06	38.0	Mab-21 protein HhH/H2TH-like domain
4	PF06785 UPF0242	2.7e+02	13.0	Uncharacterised protein family (UPF0242) N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278071

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323847	0.676	ADP-ribosylation factor-like protein 14
2	9606.ENSP00000380333	0.540	Inter-alpha-trypsin inhibitor heavy chain H5
3	9606.ENSP00000366487	0.537	ADP-ribosylation factor-like protein 5B
4	9606.ENSP00000310704	0.509	Olfactory receptor 10H5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0042981	0.969	regulation of apoptotic process
GO:0050896	0.968	response to stimulus
GO:0008219	0.968	cell death
GO:0048523	0.967	negative regulation of cellular process
GO:0007166	0.956	cell surface receptor signaling pathway
GO:0060548	0.947	negative regulation of cell death
GO:0009966	0.946	regulation of signal transduction
GO:0043066	0.938	negative regulation of apoptotic process
GO:2001233	0.912	regulation of apoptotic signaling pathway
GO:0012501	0.910	programmed cell death
GO:0006915	0.894	apoptotic process
GO:2001236	0.890	regulation of extrinsic apoptotic signaling pathway
GO:0023057	0.881	negative regulation of signaling
GO:0097190	0.865	apoptotic signaling pathway
GO:0010648	0.861	negative regulation of cell communication
GO:0009968	0.834	negative regulation of signal transduction
GO:2001234	0.732	negative regulation of apoptotic signaling pathway
GO:0097191	0.696	extrinsic apoptotic signaling pathway
GO:2001237	0.422	negative regulation of extrinsic apoptotic signaling pathway
GO:0008625	0.420	extrinsic apoptotic signaling pathway via death domain receptors
GO:1902041	0.321	regulation of extrinsic apoptotic signaling pathway via death domain receptors

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043227	0.899	membrane-bounded organelle
GO:0005622	0.884	intracellular anatomical structure
GO:0043229	0.806	intracellular organelle
GO:0005737	0.735	cytoplasm
GO:0043231	0.726	intracellular membrane-bounded organelle
GO:0005634	0.494	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]