StarFunc result for job id Q8IWB6

User Input

>input (1497 residues)
MSRAVRLPVPCPVQLGTLRNDSLEAQLHEYVKQGNYVKVKKILKKGIYVDAVNSLGQTAL
FVAALLGLRKFVDVLVDYGSDPNHRCFDGSTPVHAAAFSGNQWILSKLLDAGGDLRLHDE
RGQNPKTWALTAGKERSTQIVEFMQRCASHMQAIIQGFSYDLLKKIDSPQRLVYSPSWCG
GLVQGNPNGSPNRLLKAGVISAQNIYSFGFGKAMPWFQFYLTGATQMAYLGSLPVIGEKE
VIQADDEPTFSFFSGPYMVMTNLVWNGSRVTVKELNLPTHPHCSRLRLADLLIAEQEHSS
KLRHPYLLQLMAVCLSQDLEKTRLVYERITIGTLFSVLHERRSQFPVLHMEVIVHLLLQI
SDALRYLHFQGFIHRSLSSYAVHIISPGEARLTNLEYMLESEDRGVQRDLTRVPLPTQLY
NWAAPEVILQKAATVKSDIYSFSMIMQEILTDDIPWKGLDGSVVKKAVVSGNYLEADVRL
PKPYYDIVKSGIHVKQKDRTMNLQDIRYILKNDLKDFTGAQRTQPTESPRVQRYGLHPDV
NVYLGLTSEHPRETPDMEIIELKEMGSQPHSPRVHSLFTEGTLDPQAPDPCLMARETQNQ
DAPCPAPFMAEEASSPSTGQPSLCSFEINEIYSGCLILEDDIEEPPGAASSLEADGPNQV
DELKSMEEELDKMEREACCFGSEDESSSKAETEYSFDDWDWQNGSLSSLSLPESTREAKS
NLNNMSTTEEYLISKCVLDLKIMQTIMHENDDRLRNIEQILDEVEMKQKEQEERMSLWAT
SREFTNAYKLPLAVGPPSLNYIPPVLQLSGGQKPDTSGNYPTLPRFPRMLPTLCDPGKQN
TDEQFQCTQGAKDSLETSRIQNTSSQGRPRESTAQAKATQFNSALFTLSSHRQGPSASPS
CHWDSTRMSVEPVSSEIYNAESRNKDDGKVHLKWKMEVKEMAKKAATGQLTVPPWHPQSS
LTLESEAENEPDALLQPPIRSPENTDWQRVIEYHRENDEPRGNGKFDKTGNNDCDSDQHG
RQPRLGSFTSIRHPSPRQKEQPEHSEAFQASSDTLVAVEKSYSHQSMQSTCSPESSEDIT
DEFLTPDGEYFYSSTAQENLALETSSPIEEDFEGIQGAFAQPQVSGEEKFQMRKILGKNA
EILPRSQFQPVRSTEDEQEETSKESPKELKEKDISLTDIQDLSSISYEPDSSFKEASCKT
PKINHAPTSVSTPLSPGSVSSAASQYKDCLESITFQVKTEFASCWNSQEFIQTLSDDFIS
VRERAKKLDSLLTSSETPPSRLTGLKRLSSFIGAGSPSLVKACDSSPPHATQRRSLPKVE
AFSQHHIDELPPPSQELLDDIELLKQQQGSSTVLHENTASDGGGTANDQRHLEEQETDSK
KEDSSMLLSKETEDLGEDTERAHSTLDEDLERWLQPPEESVELQDLPKGSERETNIKDQK
VGEEKRKREDSITPERRKSEGVLGTSEEDELKSCFWKRLGWSESSRIIVLDQSDLSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7M6U3	0.382	0.393	0.000	1450	0.633	0.654	Q7M6U3.pdb.gz	TEX14_MOUSE Inactive serine/threonine-protein kinase TEX14 OS=Mus musculus OX=10090 GN=Tex14 PE=1 SV=2
2	AFDB:Q8IWB6	0.999	0.999	0.000	1497	1.000	1.000	Q8IWB6.pdb.gz	TEX14_HUMAN Inactive serine/threonine-protein kinase TEX14 OS=Homo sapiens OX=9606 GN=TEX14 PE=1 SV=2
3	AFDB:Q9I7F7	0.173	0.192	3.092E-16	1337	0.139	0.156	Q9I7F7.pdb.gz	ACKL_DROME Activated Cdc42 kinase-like OS=Drosophila melanogaster OX=7227 GN=Ack-like PE=1 SV=3
4	AFDB:P03949	0.166	0.199	2.770E-15	1224	0.094	0.115	P03949.pdb.gz	ABL1_CAEEL Tyrosine-protein kinase abl-1 OS=Caenorhabditis elegans OX=6239 GN=abl-1 PE=1 SV=4
5	AFDB:P00522	0.155	0.144	3.397E-15	1620	0.131	0.121	P00522.pdb.gz	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
6	AFDB:A0A024R8E2	0.157	0.203	3.731E-14	1130	0.098	0.129	A0A024R8E2.pdb.gz
7	PDB:4fl2A	0.145	0.366	2.439E-13	555	0.044	0.119	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
8	AFDB:Q9VE06	0.157	0.192	2.868E-13	1213	0.128	0.157	Q9VE06.pdb.gz	Q9VE06_DROME Center divider, isoform A OS=Drosophila melanogaster OX=7227 GN=cdi PE=2 SV=1
9	AFDB:F7BN18	0.151	0.197	3.894E-13	1128	0.095	0.126	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
10	PDB:1k9aB	0.154	0.486	4.732E-13	441	0.043	0.147	1k9aB.pdb.gz
11	AFDB:Q6P4S6	0.148	0.167	7.556E-13	1311	0.128	0.146	Q6P4S6.pdb.gz	SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus OX=10090 GN=Sik3 PE=1 SV=4
12	AFDB:Q96Q04	0.149	0.153	7.556E-13	1460	0.139	0.142	Q96Q04.pdb.gz	LMTK3_HUMAN Serine/threonine-protein kinase LMTK3 OS=Homo sapiens OX=9606 GN=LMTK3 PE=1 SV=2
13	PDB:2h8hA	0.151	0.457	1.070E-12	445	0.044	0.148	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
14	PDB:6lk5A	0.157	0.781	1.529E-12	265	0.032	0.181	6lk5A.pdb.gz
15	PDB:4k2rA	0.146	0.366	3.457E-12	551	0.040	0.109	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
16	PDB:4btfA	0.151	0.490	4.028E-12	413	0.051	0.186	4btfA.pdb.gz
17	PDB:8dksA	0.140	0.672	5.470E-12	283	0.037	0.194	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
18	PDB:7cgaA	0.144	0.547	7.816E-12	347	0.041	0.179	7cgaA.pdb.gz
19	PDB:7mfdA	0.148	0.473	9.107E-12	410	0.040	0.146	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
20	PDB:4c0tA	0.160	0.727	1.596E-11	291	0.032	0.165	4c0tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7M6U3	0.0	1804	1450	0.640	0.661	TEX14_MOUSE Inactive serine/threonine-protein kinase TEX14 OS=Mus musculus OX=10090 GN=Tex14 PE=1 SV=2
2	Q8IWB6	0.0	3102	1497	1.000	1.000	TEX14_HUMAN Inactive serine/threonine-protein kinase TEX14 OS=Homo sapiens OX=9606 GN=TEX14 PE=1 SV=2
3	Q2MHE4	1.49e-18	92.0	390	0.047	0.179	HT1_ARATH Serine/threonine/tyrosine-protein kinase HT1 OS=Arabidopsis thaliana OX=3702 GN=HT1 PE=1 SV=1
4	Q80XI6	1.05e-14	82.0	850	0.040	0.071	M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus OX=10090 GN=Map3k11 PE=1 SV=1
5	Q16584	1.13e-14	82.0	847	0.040	0.071	M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens OX=9606 GN=MAP3K11 PE=1 SV=1
6	Q66HA1	1.23e-14	82.0	850	0.040	0.071	M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus OX=10116 GN=Map3k11 PE=1 SV=1
7	Q59H18	1.86e-14	81.3	835	0.070	0.126	TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens OX=9606 GN=TNNI3K PE=1 SV=3
8	F4HVH9	2.76e-14	80.5	765	0.044	0.086	F4HVH9_ARATH PAS domain-containing protein tyrosine kinase family protein OS=Arabidopsis thaliana OX=3702 GN=RAF11 PE=1 SV=1
9	P80192	3.87e-14	80.5	1104	0.039	0.053	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3
10	G5EBZ8	3.93e-14	80.5	1043	0.041	0.058	ARK1_CAEEL Ack-related non-receptor tyrosine kinase OS=Caenorhabditis elegans OX=6239 GN=ark-1 PE=2 SV=1
11	Q1HKZ5	4.28e-14	80.1	959	0.037	0.057	M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus OX=10090 GN=Map3k13 PE=1 SV=1
12	Q12852	7.64e-14	79.3	859	0.037	0.064	M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens OX=9606 GN=MAP3K12 PE=1 SV=2
13	O43283	7.98e-14	79.3	966	0.037	0.057	M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens OX=9606 GN=MAP3K13 PE=1 SV=1
14	A0A0G2JUN9	9.48e-14	79.0	1078	0.039	0.054	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
15	F1LRA7	9.48e-14	79.3	1100	0.039	0.053	F1LRA7_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
16	Q60700	9.57e-14	79.0	888	0.037	0.062	M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus OX=10090 GN=Map3k12 PE=1 SV=1
17	Q9V9J3	1.08e-13	78.2	517	0.037	0.106	SRC42_DROME Tyrosine-protein kinase Src42A OS=Drosophila melanogaster OX=7227 GN=Src42A PE=1 SV=1
18	O45539	1.19e-13	77.8	507	0.038	0.112	SRC2_CAEEL Tyrosine protein-kinase src-2 OS=Caenorhabditis elegans OX=6239 GN=src-2 PE=1 SV=2
19	P00528	2.36e-13	77.0	552	0.040	0.109	SRC64_DROME Tyrosine-protein kinase Src64B OS=Drosophila melanogaster OX=7227 GN=Src64B PE=1 SV=3
20	P48025	2.77e-13	77.0	629	0.037	0.087	KSYK_MOUSE Tyrosine-protein kinase SYK OS=Mus musculus OX=10090 GN=Syk PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.2e+02	13.2	Ankyrin repeat
2	PF12796 Ank_2	8.6e-05	34.4	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.31	22.6	Ankyrin repeat
4	PF13637 Ank_4	3.2	19.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2.8	19.6	Ankyrin repeats (many copies)
6	PF19822 DUF6304	2.1e+02	13.2	Family of unknown function (DUF6304)
7	PF00069 Pkinase	1.7e-12	58.9	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	1.5e-21	88.4	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000240361

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360540	0.956	Centrosomal protein of 55 kDa
2	9606.ENSP00000321179	0.825	RNA-binding protein 44
3	9606.ENSP00000354361	0.807	E3 ubiquitin-protein ligase RFWD3
4	9606.ENSP00000385334	0.744	Mitotic spindle assembly checkpoint protein MAD1
5	9606.ENSP00000440440	0.744	Activating transcription factor 7-interacting protein 1
6	9606.ENSP00000261880	0.736	Alpha- and gamma-adaptin-binding protein p34
7	9606.ENSP00000331500	0.730	Testis-expressed protein 19
8	9606.ENSP00000350036	0.712	Structural maintenance of chromosomes protein 1B
9	9606.ENSP00000265148	0.664	Centromere-associated protein E
10	9606.ENSP00000336701	0.656	DNA repair protein RAD51 homolog 3
11	9606.ENSP00000379226	0.650	Testis-expressed protein 11
12	9606.ENSP00000315554	0.626	Spermatid maturation protein 1
13	9606.ENSP00000346065	0.626	Tudor domain-containing protein 6
14	9606.ENSP00000250863	0.612	Deleted in azoospermia-like
15	9606.ENSP00000391227	0.608	Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B
16	9606.ENSP00000295709	0.600	Serine/threonine-protein kinase 36
17	9606.ENSP00000371711	0.591	Doublesex- and mab-3-related transcription factor 1
18	9606.ENSP00000276594	0.580	PR domain zinc finger protein 14
19	9606.ENSP00000380820	0.574	Germinal-center associated nuclear protein
20	9606.ENSP00000256246	0.573	Testis-expressed protein 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019901	0.926	protein kinase binding
GO:0003824	0.782	catalytic activity
GO:0016740	0.350	transferase activity
GO:0140096	0.326	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.980	regulation of cellular process
GO:0009987	0.979	cellular process
GO:0007049	0.960	cell cycle
GO:0016043	0.905	cellular component organization
GO:0007276	0.873	gamete generation
GO:0006996	0.869	organelle organization
GO:0048523	0.866	negative regulation of cellular process
GO:0032502	0.816	developmental process
GO:0050896	0.814	response to stimulus
GO:0010564	0.809	regulation of cell cycle process
GO:0022402	0.658	cell cycle process
GO:1903047	0.654	mitotic cell cycle process
GO:0051716	0.604	cellular response to stimulus
GO:0008152	0.597	metabolic process
GO:0044237	0.553	cellular metabolic process
GO:0051128	0.552	regulation of cellular component organization
GO:0071704	0.544	organic substance metabolic process
GO:0044238	0.543	primary metabolic process
GO:0006807	0.541	nitrogen compound metabolic process
GO:0043170	0.505	macromolecule metabolic process
GO:0048285	0.459	organelle fission
GO:0000280	0.449	nuclear division
GO:0051983	0.438	regulation of chromosome segregation
GO:0010948	0.425	negative regulation of cell cycle process
GO:0033044	0.395	regulation of chromosome organization
GO:0007154	0.388	cell communication
GO:0023052	0.382	signaling
GO:1901990	0.374	regulation of mitotic cell cycle phase transition
GO:0048518	0.350	positive regulation of biological process
GO:0007059	0.350	chromosome segregation
GO:1901991	0.331	negative regulation of mitotic cell cycle phase transition
GO:0033045	0.323	regulation of sister chromatid segregation
GO:0051276	0.319	chromosome organization
GO:0048522	0.316	positive regulation of cellular process
GO:0098813	0.314	nuclear chromosome segregation
GO:0007093	0.312	mitotic cell cycle checkpoint signaling
GO:0051985	0.301	negative regulation of chromosome segregation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.995	membrane-bounded organelle
GO:0043229	0.968	intracellular organelle
GO:0043228	0.943	non-membrane-bounded organelle
GO:0043232	0.934	intracellular non-membrane-bounded organelle
GO:0043231	0.841	intracellular membrane-bounded organelle
GO:0005576	0.832	extracellular region
GO:0005737	0.780	cytoplasm
GO:0005634	0.754	nucleus
GO:0070013	0.739	intracellular organelle lumen
GO:0031982	0.592	vesicle
GO:0005615	0.530	extracellular space
GO:0043230	0.503	extracellular organelle
GO:0005829	0.490	cytosol
GO:0065010	0.489	extracellular membrane-bounded organelle
GO:1903561	0.447	extracellular vesicle
GO:0070062	0.432	extracellular exosome
GO:0031981	0.328	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.350	Transferases.

[back to server]