StarFunc result for job id Q8IWB9

User Input

>input (1127 residues)
MTSLYGRHAEKTTDMPKPSAPKVHVQRSVSRDTIAIHFSASGEEEEEEEEEFREYFEEGL
DDQSIVTGLEAKEDLYLEPQVGHDPAGPAASPVLADGLSVSQAPAILPVSKNTVKLLESP
VPAAQVLSTVPLAVSPGSSSSGPLASSPSVSSLSEQKTSSSSPLSSPSKSPILSSSASTS
TLSSAKPFMSLVKSLSTEVEPKESPHPARHRHLMKTLVKSLSTDTSRQESDTVSYKPPDS
KLNLHLFKQFTQPRNTGGDSKTAPSSPLTSPSDTRSFFKVPEMEAKIEDTKRRLSEVIYE
PFQLLSKIIGEESGSHRPKALSSSASELSNLSSLNGHLESNNNYSIKEEECDSEGDGYGS
DSNIPRSDHPKSTGEPTREIELKSSQGSSLKDLGLKTSSLVLEKCSLSALVSKEDEEFCE
LYTEDFDLETEGESKVDKLSDIPLKPEVLAEDGVVLDSEDEVDSAVQHPELPVKTLGFFI
MCVYVYLILPLPHYVSGLFLGIGLGFMTAVCVIWFFTPPSAHKYHKLHKNLRHWNTRSLD
IKEPEILKGWMNEIYNYDPETYHATLTHSVFVRLEGGTLRLSKPNKNISRRASYNEPKPE
VTYISQKIYDLSDSKIYLVPKTLARKRIWNKKYPICIELGQQDDFMSKAQTDKETSEEKP
PAEGSEDPKKPPRPQEGTRSSQRDQILYLFGRTGREKEEWFRRFILASKLKSEIKKSSGV
SGGKPGLLPAHSRHNSPSGHLTHSRSSSKGSVEEIMSQPKQKELAGSVRQKMLLDYSVYM
GRCVPQESRSPQRSPLQSAESSPTAGKKLPEVPPSEEEEQEAWVNALLGRIFWDFLGEKY
WSDLVSKKIQMKLSKIKLPYFMNELTLTELDMGVAVPKILQAFKPYVDHQGLWIDLEMSY
NGSFLMTLETKMNLTKLGKEPLVEALKVGEIGKEGCRPRAFCLADSDEESSSAGSSEEDD
APEPSGGDKQLLPGAEGYVGGHRTSKIMRFVDKITKSKYFQKATETEFIKKKIEEVSNTP
LLLTVEVQECRGTLAVNIPPPPTDRVWYGFRKPPHVELKARPKLGEREVTLVHVTDWIEK
KLEQEFQKVFVMPNMDDVYITIMHSAMDPRSTSCLLKDPPVEAADQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M9PHU7	0.345	0.313	2.940E-47	1248	0.229	0.207	M9PHU7.pdb.gz	M9PHU7_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG5741 PE=1 SV=1
2	AFDB:M9PEU6	0.330	0.307	6.665E-47	1221	0.223	0.206	M9PEU6.pdb.gz	M9PEU6_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=CG5741 PE=1 SV=1
3	AFDB:P38800	0.086	0.074	8.704E-6	1345	0.121	0.101	P38800.pdb.gz	LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAM4 PE=1 SV=1
4	AFDB:P34288	0.094	0.069	1.143E-5	1605	0.103	0.072	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
5	AFDB:A0A1D8PLJ2	0.097	0.097	2.061E-4	1141	0.123	0.122	A0A1D8PLJ2.pdb.gz	A0A1D8PLJ2_CANAL Bem3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BEM3 PE=4 SV=1
6	PDB:5gydC	0.122	0.524	8.403E-4	228	0.026	0.127	5gydC.pdb.gz
7	AFDB:P53950	0.045	0.044	8.518E-4	1165	0.119	0.115	P53950.pdb.gz	VAC7_YEAST Vacuolar segregation protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAC7 PE=1 SV=1
8	AFDB:Q9NYF8	0.041	0.047	8.995E-4	920	0.102	0.125	Q9NYF8.pdb.gz	BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2
9	AFDB:O44757	0.044	0.039	4.378E-3	1312	0.068	0.059	O44757.pdb.gz	LIN59_CAEEL Probable histone-lysine N-methyltransferase lin-59 OS=Caenorhabditis elegans OX=6239 GN=lin-59 PE=2 SV=1
10	AFDB:Q8WTI7	0.049	0.052	4.378E-3	1041	0.136	0.147	Q8WTI7.pdb.gz	Q8WTI7_DROME PFTAIRE-interacting factor 1B OS=Drosophila melanogaster OX=7227 GN=Pif1B PE=1 SV=1
11	AFDB:Q9VGI1	0.047	0.041	5.157E-3	1354	0.101	0.084	Q9VGI1.pdb.gz	Q9VGI1_DROME FI23955p1 OS=Drosophila melanogaster OX=7227 GN=prd1 PE=2 SV=1
12	PDB:4mt6A	0.079	0.205	7.058E-3	389	0.023	0.067	4mt6A.pdb.gz
13	PDB:2kr0A	0.082	0.192	3.627E-2	407	0.035	0.096	2kr0A.pdb.gz
14	PDB:7rx9A	0.083	0.205	9.172E-2	432	0.026	0.067	7rx9A.pdb.gz
15	PDB:3zpmA	0.074	0.250	1.419E-1	211	0.026	0.137	3zpmA.pdb.gz
16	PDB:3ljuX	0.072	0.192	1.499E-1	373	0.016	0.048	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
17	PDB:7mp5A	0.074	0.052	1.583E-1	1629	0.016	0.011	7mp5A.pdb.gz
18	PDB:6bbpA	0.073	0.146	1.765E-1	520	0.018	0.038	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
19	PDB:7r04A	0.073	0.037	2.079E-1	2326	0.017	0.008	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
20	PDB:7r04B	0.072	0.038	2.079E-1	2229	0.017	0.009	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M9PF18	6.69e-58	218	913	0.163	0.202	M9PF18_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=CG43113 PE=1 SV=1
2	M9PBY3	7.07e-58	218	914	0.163	0.201	M9PBY3_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=CG43113 PE=1 SV=1
3	M9PEK7	8.16e-58	218	887	0.161	0.205	M9PEK7_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=CG5741 PE=1 SV=1
4	M9PHU7	1.09e-57	220	1248	0.163	0.147	M9PHU7_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG5741 PE=1 SV=1
5	M9PEU6	1.17e-57	220	1221	0.161	0.148	M9PEU6_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=CG5741 PE=1 SV=1
6	Q9CAT4	8.02e-22	104	779	0.066	0.095	Q9CAT4_ARATH Testis-expressed sequence 2-like protein (DUF2404) OS=Arabidopsis thaliana OX=3702 GN=At1g73200 PE=1 SV=1
7	O94464	7.68e-10	65.5	779	0.025	0.036	NVJ2_SCHPO Nucleus-vacuole junction protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nvj2 PE=1 SV=3
8	A0A1D8PNV5	2.76e-09	63.9	931	0.031	0.038	A0A1D8PNV5_CANAL SMP-LTD domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C504050WA PE=4 SV=1
9	Q06833	1.02e-07	58.9	770	0.022	0.032	NVJ2_YEAST Nucleus-vacuole junction protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NVJ2 PE=1 SV=1
10	P41800	0.21	37.7	426	0.030	0.080	MMM1_YEAST Maintenance of mitochondrial morphology protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MMM1 PE=1 SV=2
11	Q91YE5	0.22	38.1	1889	0.043	0.025	BAZ2A_MOUSE Bromodomain adjacent to zinc finger domain protein 2A OS=Mus musculus OX=10090 GN=Baz2a PE=1 SV=2
12	Q8ILJ9	0.65	36.6	660	0.038	0.065	Q8ILJ9_PLAF7 ABC transporter G family member 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1426500 PE=4 SV=1
13	P93654	4.0	33.5	268	0.031	0.131	SYP22_ARATH Syntaxin-22 OS=Arabidopsis thaliana OX=3702 GN=SYP22 PE=1 SV=1
14	P96956	4.1	33.9	475	0.017	0.040	ALGK_PSEAE Alginate biosynthesis protein AlgK OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=algK PE=1 SV=1
15	Q54BM7	7.3	33.1	1053	0.013	0.014	PPK1_DICDI Polyphosphate kinase OS=Dictyostelium discoideum OX=44689 GN=ppkA PE=1 SV=1
16	Q9VF02	7.4	33.1	1923	0.018	0.010	Q9VF02_DROME Helicase 89B, isoform B OS=Drosophila melanogaster OX=7227 GN=Hel89B PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10296 MMM1	11	16.6	Maintenance of mitochondrial morphology protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003811411.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008956436.1	0.786	Tetratricopeptide repeat domain 7B
2	9597.XP_008964926.1	0.703	RAN binding protein 1
3	9597.XP_003826215.1	0.699	NF-kappa-B inhibitor-interacting Ras-like protein 1
4	9597.XP_008966761.1	0.674	Lunapark, ER junction formation factor
5	9597.XP_003825896.1	0.669	Nck-associated protein 5-like isoform X1
6	9597.XP_003814071.1	0.664	THO complex 3
7	9597.XP_008974847.1	0.664	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium.
8	9597.XP_003810544.1	0.653	3'-phosphoadenosine 5'-phosphosulfate synthase 2
9	9597.XP_003824518.1	0.622	ARV1 homolog, fatty acid homeostasis modulator
10	9597.XP_003809363.1	0.614	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family
11	9597.XP_008970830.1	0.605	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 47 ESTs, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns
12	9597.XP_003809948.1	0.585	Baculoviral IAP repeat containing 7
13	9597.XP_003815349.1	0.583	Cytoplasmic polyadenylation element binding protein 1
14	9597.XP_003828579.1	0.583	Atlastin-3 isoform X1
15	9597.XP_003830294.1	0.583	Nucleolar protein 4 isoform X1
16	9597.XP_008975438.1	0.573	Sperm specific antigen 2
17	9597.XP_008950298.1	0.565	Sperm associated antigen 17
18	9597.XP_003830656.1	0.554	Leucine rich repeat containing 40
19	9597.XP_003810930.1	0.550	Sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1
20	9597.XP_008955456.1	0.546	Nuclear receptor coactivator 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.637	biological regulation
GO:0008152	0.563	metabolic process
GO:0050789	0.525	regulation of biological process
GO:0051179	0.425	localization
GO:0051234	0.404	establishment of localization
GO:0006810	0.389	transport
GO:0044237	0.361	cellular metabolic process
GO:0071704	0.350	organic substance metabolic process
GO:0050794	0.320	regulation of cellular process
GO:0044238	0.305	primary metabolic process
GO:0071840	0.304	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005783	0.973	endoplasmic reticulum
GO:0016020	0.877	membrane
GO:0005829	0.872	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]