StarFunc result for job id Q8IWD4

User Input

>input (279 residues)
MAALGRPFSGLPLSGGSDFLQPPQPAFPGRAFPPGADGAELAPRPGPRAVPSSPAGSAAR
GRVSVHCKKKHKREEEEDDDCPVRKKRITEAELCAGPNDWILCAHQDVEGHGVNPSVSGL
SIPGILDVICEEMDQTTGEPQCEVARRKLQEIEDRIIDEDEEVEADRNVNHLPSLVLSDT
MKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNTKNYTGESQAKHV
AAGTAFPQRTELFSEPRPTGMSLYNSLETATSTEEEMEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IWD4	1.000	1.000	3.185E-40	279	1.000	1.000	Q8IWD4.pdb.gz	CC117_HUMAN Coiled-coil domain-containing protein 117 OS=Homo sapiens OX=9606 GN=CCDC117 PE=1 SV=1
2	AFDB:Q9SHG6	0.126	0.055	1.578E-1	849	0.129	0.042	Q9SHG6.pdb.gz	STIP1_ARATH Septin and tuftelin-interacting protein 1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=STIPL1 PE=1 SV=1
3	AFDB:Q9ARH1	0.079	0.038	2.914E-1	647	0.158	0.068	Q9ARH1.pdb.gz	Q9ARH1_BRANA non-specific serine/threonine protein kinase OS=Brassica napus OX=3708 PE=2 SV=1
4	AFDB:Q9SZR6	0.104	0.100	2.914E-1	291	0.111	0.107	Q9SZR6.pdb.gz	Q9SZR6_ARATH Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=EBS7 PE=1 SV=1
5	AFDB:O14639	0.082	0.035	3.339E-1	778	0.161	0.058	O14639.pdb.gz	ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1 PE=1 SV=3
6	AFDB:Q9C519	0.098	0.058	3.339E-1	553	0.151	0.076	Q9C519.pdb.gz	WRKY6_ARATH WRKY transcription factor 6 OS=Arabidopsis thaliana OX=3702 GN=WRKY6 PE=1 SV=1
7	AFDB:P12980	0.123	0.122	3.575E-1	280	0.183	0.182	P12980.pdb.gz	LYL1_HUMAN Protein lyl-1 OS=Homo sapiens OX=9606 GN=LYL1 PE=1 SV=3
8	AFDB:O96668	0.112	0.026	4.096E-1	1402	0.104	0.021	O96668.pdb.gz	DTFA_DICDI Defective in tip formation protein A OS=Dictyostelium discoideum OX=44689 GN=dtfA PE=2 SV=2
9	AFDB:Q38A03	0.143	0.123	4.096E-1	333	0.179	0.150	Q38A03.pdb.gz	Q38A03_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0600 PE=4 SV=1
10	AFDB:O88623	0.068	0.036	4.385E-1	613	0.158	0.072	O88623.pdb.gz	UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus OX=10090 GN=Usp2 PE=1 SV=3
11	PDB:5a20A	0.075	0.055	3.982	439	0.043	0.027	5a20A.pdb.gz
12	PDB:4gwqB	0.086	0.060	4.885	492	0.036	0.020	4gwqB.pdb.gz	Structure of the Mediator Head module bound to the carboxy-terminal domain of RNA polymerase II.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IWD4	0.0	571	279	1.000	1.000	CC117_HUMAN Coiled-coil domain-containing protein 117 OS=Homo sapiens OX=9606 GN=CCDC117 PE=1 SV=1
2	Q54RJ3	0.11	36.6	652	0.047	0.020	Q54RJ3_DICDI Centrosomal protein 75 kDa OS=Dictyostelium discoideum OX=44689 GN=DDB_G0283111 PE=4 SV=1
3	Q941D6	1.3	32.7	423	0.075	0.050	HDA14_ARATH Histone deacetylase 14, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HDA14 PE=1 SV=1
4	P34109	2.1	32.3	1109	0.065	0.016	MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoD PE=1 SV=2
5	Q7Z5N4	3.6	31.6	2213	0.082	0.010	SDK1_HUMAN Protein sidekick-1 OS=Homo sapiens OX=9606 GN=SDK1 PE=2 SV=3
6	Q39022	7.2	30.4	376	0.072	0.053	MPK2_ARATH Mitogen-activated protein kinase 2 OS=Arabidopsis thaliana OX=3702 GN=MPK2 PE=1 SV=2
7	X2J9P4	8.0	30.4	940	0.050	0.015	X2J9P4_DROME Dipeptidyl peptidase 10, isoform B OS=Drosophila melanogaster OX=7227 GN=Dpp10 PE=4 SV=1
8	Q8VY26	9.3	30.4	570	0.054	0.026	CCD8_ARATH Carotenoid cleavage dioxygenase 8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CCD8 PE=1 SV=1
9	Q9VMB4	9.4	30.4	935	0.050	0.015	Q9VMB4_DROME Dipeptidyl peptidase 10, isoform A OS=Drosophila melanogaster OX=7227 GN=Dpp10 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15810 CCDC117	5e-55	197.2	Coiled-coil domain-containing protein 117

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000249064

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242827	0.690	Emopamil-binding protein-like
2	9606.ENSP00000351646	0.682	Stress-induced-phosphoprotein 1
3	9606.ENSP00000359819	0.668	Motile sperm domain-containing protein 1
4	9606.ENSP00000299238	0.633	Hermansky-Pudlak syndrome 6 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0048583	0.971	regulation of response to stimulus
GO:0060255	0.939	regulation of macromolecule metabolic process
GO:0048522	0.935	positive regulation of cellular process
GO:0019219	0.935	regulation of nucleobase-containing compound metabolic process
GO:0009893	0.926	positive regulation of metabolic process
GO:0010604	0.923	positive regulation of macromolecule metabolic process
GO:0051173	0.921	positive regulation of nitrogen compound metabolic process
GO:0031325	0.921	positive regulation of cellular metabolic process
GO:0080134	0.874	regulation of response to stress
GO:0048584	0.830	positive regulation of response to stimulus
GO:0045935	0.821	positive regulation of nucleobase-containing compound metabolic process
GO:0051052	0.783	regulation of DNA metabolic process
GO:0080135	0.726	regulation of cellular response to stress
GO:0042127	0.719	regulation of cell population proliferation
GO:0009987	0.718	cellular process
GO:0051054	0.678	positive regulation of DNA metabolic process
GO:2001020	0.642	regulation of response to DNA damage stimulus
GO:2001022	0.607	positive regulation of response to DNA damage stimulus
GO:0006282	0.578	regulation of DNA repair
GO:0045739	0.555	positive regulation of DNA repair
GO:0071704	0.331	organic substance metabolic process
GO:0044237	0.315	cellular metabolic process
GO:0044238	0.302	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005819	0.997	spindle
GO:0072686	0.993	mitotic spindle
GO:0043231	0.945	intracellular membrane-bounded organelle
GO:0005737	0.908	cytoplasm
GO:0005634	0.883	nucleus
GO:0016020	0.794	membrane
GO:0005654	0.556	nucleoplasm
GO:0012505	0.493	endomembrane system
GO:0005829	0.420	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]