StarFunc result for job id Q8IWE4

User Input

>input (304 residues)
MGQCVTKCKNPSSTLGSKNGDREPSNKSHSRRGAGHREEQVPPCGKPGGDILVNGTKKAE
AATEACQLPTSSGDAGRESKSNAEESSLQRLEELFRRYKDEREDAILEEGMERFCNDLCV
DPTEFRVLLLAWKFQAATMCKFTRKEFFDGCKAISADSIDGICARFPSLLTEAKQEDKFK
DLYRFTFQFGLDSEEGQRSLHREIAIALWKLVFTQNNPPVLDQWLNFLTENPSGIKGISR
DTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMERRKREGEGRGALSSGPEGLCP
EEQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IWE4	1.000	1.000	9.531E-45	304	1.000	1.000	Q8IWE4.pdb.gz	DCNL3_HUMAN DCN1-like protein 3 OS=Homo sapiens OX=9606 GN=DCUN1D3 PE=1 SV=1
2	AFDB:Q8T8S1	0.636	0.584	1.261E-17	334	0.355	0.323	Q8T8S1.pdb.gz	Q8T8S1_DROME Defective in cullin neddylation protein OS=Drosophila melanogaster OX=7227 GN=SCCRO3 PE=2 SV=1
3	AFDB:Q6PH85	0.585	0.684	1.775E-16	259	0.283	0.332	Q6PH85.pdb.gz	DCNL2_HUMAN DCN1-like protein 2 OS=Homo sapiens OX=9606 GN=DCUN1D2 PE=1 SV=1
4	AFDB:Q96GG9	0.600	0.700	2.534E-16	259	0.280	0.328	Q96GG9.pdb.gz	DCNL1_HUMAN DCN1-like protein 1 OS=Homo sapiens OX=9606 GN=DCUN1D1 PE=1 SV=1
5	AFDB:Q5PPL2	0.604	0.771	3.617E-16	237	0.234	0.300	Q5PPL2.pdb.gz	DCNL5_RAT DCN1-like protein 5 OS=Rattus norvegicus OX=10116 GN=Dcun1d5 PE=2 SV=1
6	PDB:6bg3A	0.601	0.501	5.108E-16	366	0.273	0.227	6bg3A.pdb.gz	Piperidinyl Ureas Chemically Control Defective in Cullin Neddylation 1 (DCN1)-Mediated Cullin Neddylation.
7	AFDB:Q9VUQ8	0.586	0.618	7.006E-16	288	0.263	0.278	Q9VUQ8.pdb.gz	DCN1L_DROME DCN1-like protein OS=Drosophila melanogaster OX=7227 GN=CG7427 PE=2 SV=2
8	AFDB:Q92564	0.610	0.634	1.428E-15	292	0.237	0.247	Q92564.pdb.gz	DCNL4_HUMAN DCN1-like protein 4 OS=Homo sapiens OX=9606 GN=DCUN1D4 PE=1 SV=2
9	AFDB:Q9VWB1	0.630	0.769	2.038E-15	248	0.234	0.286	Q9VWB1.pdb.gz	Q9VWB1_DROME Defective in cullin neddylation protein OS=Drosophila melanogaster OX=7227 GN=SCCRO4 PE=2 SV=2
10	AFDB:Q9U3C8	0.551	0.566	1.023E-13	295	0.230	0.237	Q9U3C8.pdb.gz	DCN1_CAEEL Defective in cullin neddylation protein 1 OS=Caenorhabditis elegans OX=6239 GN=dcn-1 PE=1 SV=2
11	AFDB:Q8WZK4	0.571	0.680	3.546E-11	251	0.164	0.199	Q8WZK4.pdb.gz	DCN1_SCHPO Defective in cullin neddylation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dcn1 PE=3 SV=1
12	PDB:3bq3A	0.548	0.657	2.846E-7	250	0.148	0.180	3bq3A.pdb.gz
13	PDB:2becA	0.252	0.357	5.137E-2	181	0.079	0.133	2becA.pdb.gz	Crystal structure of CHP2 complexed with NHE1-cytosolic region and an implication for pH regulation
14	PDB:1s1eA	0.237	0.340	9.457E-2	181	0.076	0.127	1s1eA.pdb.gz	Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
15	PDB:4il1A	0.253	0.166	1.047E-1	529	0.079	0.045	4il1A.pdb.gz	Structural basis of calcineurin activation by calmodulin.
16	PDB:2n6aA	0.178	0.301	1.573E-1	162	0.056	0.105	2n6aA.pdb.gz	An investigation of calcium mediate signaling by the Connexin 36 gap junction protein
17	PDB:2zfdA	0.211	0.305	1.655E-1	183	0.082	0.137	2zfdA.pdb.gz	The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
18	PDB:6tz8B	0.255	0.378	2.134E-1	174	0.095	0.167	6tz8B.pdb.gz	Harnessing calcineurin-FK506-FKBP12 crystal structures from invasive fungal pathogens to develop antifungal agents.
19	PDB:1v1fA	0.271	0.388	2.751E-1	188	0.069	0.112	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response
20	PDB:4e53A	0.178	0.294	2.895E-1	168	0.066	0.119	4e53A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IWE4	0.0	627	304	1.000	1.000	DCNL3_HUMAN DCN1-like protein 3 OS=Homo sapiens OX=9606 GN=DCUN1D3 PE=1 SV=1
2	Q8T8S1	6.01e-56	186	334	0.342	0.311	Q8T8S1_DROME Defective in cullin neddylation protein OS=Drosophila melanogaster OX=7227 GN=SCCRO3 PE=2 SV=1
3	Q6PH85	3.99e-51	171	259	0.303	0.355	DCNL2_HUMAN DCN1-like protein 2 OS=Homo sapiens OX=9606 GN=DCUN1D2 PE=1 SV=1
4	C9JVE2	7.49e-49	164	244	0.273	0.340	C9JVE2_HUMAN DCN1-like protein OS=Homo sapiens OX=9606 GN=DCUN1D1 PE=1 SV=1
5	Q96GG9	7.87e-49	165	259	0.273	0.320	DCNL1_HUMAN DCN1-like protein 1 OS=Homo sapiens OX=9606 GN=DCUN1D1 PE=1 SV=1
6	Q9VUQ8	4.96e-39	140	288	0.257	0.271	DCN1L_DROME DCN1-like protein OS=Drosophila melanogaster OX=7227 GN=CG7427 PE=2 SV=2
7	Q9CXV9	6.22e-30	115	237	0.234	0.300	DCNL5_MOUSE DCN1-like protein 5 OS=Mus musculus OX=10090 GN=Dcun1d5 PE=1 SV=1
8	Q5PPL2	6.42e-30	115	237	0.207	0.266	DCNL5_RAT DCN1-like protein 5 OS=Rattus norvegicus OX=10116 GN=Dcun1d5 PE=2 SV=1
9	Q9U3C8	1.22e-29	116	295	0.243	0.251	DCN1_CAEEL Defective in cullin neddylation protein 1 OS=Caenorhabditis elegans OX=6239 GN=dcn-1 PE=1 SV=2
10	Q9BTE7	3.10e-29	113	237	0.204	0.262	DCNL5_HUMAN DCN1-like protein 5 OS=Homo sapiens OX=9606 GN=DCUN1D5 PE=1 SV=1
11	Q1RMX9	3.65e-29	113	236	0.204	0.263	DCNL5_BOVIN DCN1-like protein 5 OS=Bos taurus OX=9913 GN=DCUN1D5 PE=2 SV=1
12	Q5RDF9	1.35e-28	112	237	0.197	0.253	DCNL5_PONAB DCN1-like protein 5 OS=Pongo abelii OX=9601 GN=DCUN1D5 PE=2 SV=1
13	Q92564	2.75e-28	112	292	0.237	0.247	DCNL4_HUMAN DCN1-like protein 4 OS=Homo sapiens OX=9606 GN=DCUN1D4 PE=1 SV=2
14	Q9VWB1	3.67e-26	105	248	0.234	0.286	Q9VWB1_DROME Defective in cullin neddylation protein OS=Drosophila melanogaster OX=7227 GN=SCCRO4 PE=2 SV=2
15	M9MRX5	6.77e-26	103	213	0.197	0.282	M9MRX5_DROME Defective in cullin neddylation protein OS=Drosophila melanogaster OX=7227 GN=SCCRO4 PE=4 SV=1
16	C9J8R4	6.20e-19	83.2	128	0.118	0.281	C9J8R4_HUMAN DCN1-like protein (Fragment) OS=Homo sapiens OX=9606 GN=DCUN1D1 PE=1 SV=1
17	Q8WZK4	6.06e-15	75.1	251	0.161	0.195	DCN1_SCHPO Defective in cullin neddylation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dcn1 PE=3 SV=1
18	Q38A65	1.49e-10	62.4	241	0.128	0.162	Q38A65_TRYB2 Defective in cullin neddylation protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1330 PE=4 SV=1
19	Q9MBG8	8.49e-10	60.8	295	0.125	0.129	AAR3_ARATH Defective in cullin neddylation protein AAR3 OS=Arabidopsis thaliana OX=3702 GN=AAR3 PE=2 SV=1
20	Q12395	2.08e-07	53.5	269	0.141	0.160	DCN1_YEAST Defective in cullin neddylation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03556 Cullin_binding	3.4e-30	116.3	Cullin binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000319482

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478474	0.977	NEDD8-conjugating enzyme UBE2F
2	9606.ENSP00000253023	0.965	NEDD8-conjugating enzyme Ubc12
3	9606.ENSP00000338173	0.927	Pumilio homolog 2
4	9606.ENSP00000264414	0.921	Cullin-3
5	9606.ENSP00000444856	0.920	Cullin-2
6	9606.ENSP00000442318	0.896	Cullin-associated NEDD8-dissociated protein 1
7	9606.ENSP00000326804	0.886	Cullin-1
8	9606.ENSP00000216225	0.847	E3 ubiquitin-protein ligase RBX1
9	9606.ENSP00000376808	0.837	Cullin-5
10	9606.ENSP00000384109	0.745	Cullin-4B
11	9606.ENSP00000364589	0.739	Cullin-4A
12	9606.ENSP00000354340	0.655	NEDD8-activating enzyme E1 catalytic subunit
13	9606.ENSP00000273480	0.630	RING-box protein 2
14	9606.ENSP00000268616	0.616	Zinc finger CCHC domain-containing protein 14
15	9606.ENSP00000348596	0.599	Protein SDA1 homolog
16	9606.ENSP00000296955	0.588	Discoidin, CUB and LCCL domain containing 1
17	9606.ENSP00000311360	0.586	Cell cycle checkpoint control protein RAD9A
18	9606.ENSP00000250495	0.570	NEDD8
19	9606.ENSP00000354498	0.569	Pleckstrin homology like domain family B member 1
20	9606.ENSP00000360107	0.542	EF-hand domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0097602	1.000	cullin family protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:1903322	0.980	positive regulation of protein modification by small protein conjugation or removal
GO:0048523	0.937	negative regulation of cellular process
GO:0050896	0.935	response to stimulus
GO:1901990	0.921	regulation of mitotic cell cycle phase transition
GO:0010212	0.881	response to ionizing radiation
GO:1902806	0.858	regulation of cell cycle G1/S phase transition
GO:0009411	0.846	response to UV
GO:0048522	0.817	positive regulation of cellular process
GO:0009987	0.812	cellular process
GO:1901988	0.798	negative regulation of cell cycle phase transition
GO:0051128	0.733	regulation of cellular component organization
GO:1901991	0.728	negative regulation of mitotic cell cycle phase transition
GO:2000045	0.723	regulation of G1/S transition of mitotic cell cycle
GO:1902807	0.692	negative regulation of cell cycle G1/S phase transition
GO:0010332	0.691	response to gamma radiation
GO:2000134	0.676	negative regulation of G1/S transition of mitotic cell cycle
GO:0010225	0.618	response to UV-C
GO:0040008	0.610	regulation of growth
GO:0001558	0.542	regulation of cell growth
GO:0051172	0.464	negative regulation of nitrogen compound metabolic process
GO:0071704	0.397	organic substance metabolic process
GO:0044238	0.342	primary metabolic process
GO:0051248	0.335	negative regulation of protein metabolic process
GO:0006807	0.332	nitrogen compound metabolic process
GO:0043170	0.331	macromolecule metabolic process
GO:0031400	0.329	negative regulation of protein modification process
GO:0042981	0.328	regulation of apoptotic process
GO:0051716	0.315	cellular response to stimulus
GO:1903321	0.308	negative regulation of protein modification by small protein conjugation or removal

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.999	nucleus
GO:0005886	0.989	plasma membrane
GO:0031981	0.966	nuclear lumen
GO:0005829	0.965	cytosol
GO:0005654	0.919	nucleoplasm
GO:0048471	0.793	perinuclear region of cytoplasm
GO:0032991	0.478	protein-containing complex
GO:0012505	0.318	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]