StarFunc result for job id Q8IWE5

User Input

>input (1019 residues)
MEPGEVKDRILENISLSVKKLQSYFAACEDEIPAIRNHDKVLQRLCEHLDHALLYGLQDL
SSGYWVLVVHFTRREAIKQIEVLQHVATNLGRSRAWLYLALNENSLESYLRLFQENLGLL
HKYYVKNALVCSHDHLTLFLTLVSGLEFIRFELDLDAPYLDLAPYMPDYYKPQYLLDFED
RLPSSVHGSDSLSLNSFNSVTSTNLEWDDSAIAPSSEDYDFGDVFPAVPSVPSTDWEDGD
LTDTVSGPRSTASDLTSSKASTRSPTQRQNPFNEEPAETVSSSDTTPVHTTSQEKEEAQA
LDPPDACTELEVIRVTKKKKIGKKKKSRSDEEASPLHPACSQKKCAKQGDGDSRNGSPSL
GRDSPDTMLASPQEEGEGPSSTTESSERSEPGLLIPEMKDTSMERLGQPLSKVIDQLNGQ
LDPSTWCSRAEPPDQSFRTGSPGDAPERPPLCDFSEGLSAPMDFYRFTVESPSTVTSGGG
HHDPAGLGQPLHVPSSPEAAGQEEEGGGGEGQTPRPLEDTTREAQELEAQLSLVREGPVS
EPEPGTQEVLCQLKRDQPSPCLSSAEDSGVDEGQGSPSEMVHSSEFRVDNNHLLLLMIHV
FRENEEQLFKMIRMSTGHMEGNLQLLYVLLTDCYVYLLRKGATEKPYLVEEAVSYNELDY
VSVGLDQQTVKLVCTNRRKQFLLDTADVALAEFFLASLKSAMIKGCREPPYPSILTDATM
EKLALAKFVAQESKCEASAVTVRFYGLVHWEDPTDESLGPTPCHCSPPEGTITKEGMLHY
KAGTSYLGKEHWKTCFVVLSNGILYQYPDRTDVIPLLSVNMGGEQCGGCRRANTTDRPHA
FQVILSDRPCLELSAESEAEMAEWMQHLCQAVSKGVIPQGVAPSPCIPCCLVLTDDRLFT
CHEDCQTSFFRSLGTAKLGDISAVSTEPGKEYCVLEFSQDSQQLLPPWVIYLSCTSELDR
LLSALNSGWKTIYQVDLPHTAIQEASNKKKFEDALSLIHSAWQRSDSLCRGRASRDPWC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IWE5	1.000	1.000	0.000	1019	1.000	1.000	Q8IWE5.pdb.gz	PKHM2_HUMAN Pleckstrin homology domain-containing family M member 2 OS=Homo sapiens OX=9606 GN=PLEKHM2 PE=1 SV=2
2	AFDB:Q9VGI1	0.262	0.208	5.705E-28	1354	0.168	0.126	Q9VGI1.pdb.gz	Q9VGI1_DROME FI23955p1 OS=Drosophila melanogaster OX=7227 GN=prd1 PE=2 SV=1
3	AFDB:M9PC26	0.099	0.056	1.715E-7	2021	0.136	0.069	M9PC26.pdb.gz	M9PC26_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=CG10020 PE=1 SV=1
4	PDB:3ljuX	0.093	0.242	5.405E-6	373	0.034	0.094	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
5	PDB:6u3eA	0.084	0.209	3.398E-5	397	0.025	0.063	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
6	AFDB:Q6ZNL6	0.113	0.085	6.032E-5	1462	0.114	0.079	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
7	PDB:7nkyQ	0.077	0.165	6.482E-5	404	0.044	0.111	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
8	PDB:6xtbE	0.092	0.280	1.300E-4	235	0.031	0.136	6xtbE.pdb.gz
9	PDB:6hhgA	0.082	0.206	1.585E-4	386	0.028	0.075	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
10	PDB:6bbpA	0.083	0.158	1.934E-4	520	0.029	0.058	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
11	AFDB:P38800	0.106	0.086	2.958E-4	1345	0.111	0.084	P38800.pdb.gz	LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAM4 PE=1 SV=1
12	PDB:7c3mA	0.077	0.126	3.179E-4	577	0.033	0.059	7c3mA.pdb.gz
13	AFDB:Q99KW3	0.101	0.055	3.433E-4	2014	0.147	0.074	Q99KW3.pdb.gz	TARA_MOUSE TRIO and F-actin-binding protein OS=Mus musculus OX=10090 GN=Triobp PE=1 SV=3
14	PDB:6s9wA	0.080	0.189	7.397E-4	411	0.032	0.080	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
15	PDB:3uzsA	0.094	0.152	7.774E-4	609	0.024	0.039	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
16	PDB:4mk0A	0.090	0.142	8.170E-4	631	0.026	0.043	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
17	AFDB:Q9H2D6	0.082	0.038	5.278E-3	2365	0.123	0.053	Q9H2D6.pdb.gz	TARA_HUMAN TRIO and F-actin-binding protein OS=Homo sapiens OX=9606 GN=TRIOBP PE=1 SV=3
18	AFDB:P34288	0.087	0.058	1.921E-2	1605	0.080	0.051	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
19	AFDB:O15040	0.057	0.047	2.720E-2	1411	0.109	0.079	O15040.pdb.gz	TCPR2_HUMAN Tectonin beta-propeller repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=TECPR2 PE=1 SV=4
20	AFDB:Q13387	0.078	0.094	2.859E-2	824	0.110	0.136	Q13387.pdb.gz	JIP2_HUMAN C-Jun-amino-terminal kinase-interacting protein 2 OS=Homo sapiens OX=9606 GN=MAPK8IP2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IWE5	0.0	2102	1019	1.000	1.000	PKHM2_HUMAN Pleckstrin homology domain-containing family M member 2 OS=Homo sapiens OX=9606 GN=PLEKHM2 PE=1 SV=2
2	A0A0B4KH60	2.78e-19	96.7	1330	0.083	0.064	A0A0B4KH60_DROME Pruning defect 1, isoform B OS=Drosophila melanogaster OX=7227 GN=prd1 PE=4 SV=1
3	Q9VGI1	3.46e-19	96.3	1354	0.083	0.063	Q9VGI1_DROME FI23955p1 OS=Drosophila melanogaster OX=7227 GN=prd1 PE=2 SV=1
4	Q6NR50	3.72e-19	95.9	1186	0.083	0.072	Q6NR50_DROME RE61780p OS=Drosophila melanogaster OX=7227 GN=prd1 PE=2 SV=1
5	Q9Y4G2	2.66e-11	70.5	1056	0.034	0.033	PKHM1_HUMAN Pleckstrin homology domain-containing family M member 1 OS=Homo sapiens OX=9606 GN=PLEKHM1 PE=1 SV=3
6	Q7TSI1	5.20e-10	66.2	1074	0.032	0.031	PKHM1_MOUSE Pleckstrin homology domain-containing family M member 1 OS=Mus musculus OX=10090 GN=Plekhm1 PE=1 SV=1
7	K8ESM7	1.48e-08	61.2	955	0.027	0.029	K8ESM7_CAEEL RUN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cup-14 PE=1 SV=1
8	Q96T51	4.48e-06	53.1	708	0.037	0.054	RUFY1_HUMAN RUN and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RUFY1 PE=1 SV=2
9	Q8BIJ7	4.76e-05	49.7	712	0.028	0.041	RUFY1_MOUSE RUN and FYVE domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rufy1 PE=1 SV=1
10	H0YAC8	7.62e-05	48.1	271	0.032	0.122	H0YAC8_HUMAN RUN and FYVE domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=RUFY1 PE=1 SV=1
11	Q59EK9	2.00e-04	47.4	446	0.042	0.096	RUN3A_HUMAN RUN domain-containing protein 3A OS=Homo sapiens OX=9606 GN=RUNDC3A PE=1 SV=2
12	A0A0B4LHR8	6.14e-04	46.2	877	0.033	0.039	A0A0B4LHR8_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG14261 PE=1 SV=1
13	Q8IMP2	7.60e-04	45.8	729	0.033	0.047	Q8IMP2_DROME LD28220p OS=Drosophila melanogaster OX=7227 GN=CG14261 PE=1 SV=1
14	A0A0B4LHR2	8.26e-04	45.8	815	0.033	0.042	A0A0B4LHR2_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=CG6001 PE=4 SV=1
15	A0A126GV26	0.001	45.4	700	0.033	0.049	A0A126GV26_DROME Uncharacterized protein, isoform H OS=Drosophila melanogaster OX=7227 GN=Dmel\CG31064 PE=4 SV=1
16	Q8IMP0	0.001	45.8	862	0.033	0.039	Q8IMP0_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=RUFY1 PE=4 SV=1
17	Q8IMP1	0.001	45.1	667	0.033	0.051	Q8IMP1_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=CG14261 PE=1 SV=1
18	Q961F7	0.001	45.1	587	0.033	0.058	Q961F7_DROME GH26613p OS=Drosophila melanogaster OX=7227 GN=CG6001 PE=2 SV=1
19	F1LRZ9	0.002	44.3	454	0.041	0.093	F1LRZ9_RAT RUN domain-containing protein 3A OS=Rattus norvegicus OX=10116 GN=Rundc3a PE=1 SV=1
20	A1L117	0.005	42.7	394	0.034	0.089	A1L117_RAT Rap2ip protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Rundc3a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	1.7e-08	46.3	PH domain
2	PF15410 PH_9	0.088	24.4	Pleckstrin homology domain
3	PF02759 RUN	2.1e-09	49.0	RUN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364956

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420127	0.868	Ras-related protein Rab-9A
2	9606.ENSP00000243298	0.822	Ras-related protein Rab-9B
3	9606.ENSP00000307078	0.771	Kinesin-1 heavy chain
4	9606.ENSP00000256496	0.689	ADP-ribosylation factor-like protein 8B
5	9606.ENSP00000366487	0.636	ADP-ribosylation factor-like protein 5B
6	9606.ENSP00000399403	0.628	Kinesin light chain 2
7	9606.ENSP00000335193	0.621	Vam6/Vps39-like protein
8	9606.ENSP00000258198	0.618	Cytoplasmic dynein 1 light intermediate chain 2
9	9606.ENSP00000389631	0.605	Actin-related protein 2/3 complex subunit 1B
10	9606.ENSP00000321546	0.603	BLOC-1-related complex subunit 5
11	9606.ENSP00000295685	0.593	Actin-related protein 2/3 complex subunit 2
12	9606.ENSP00000414982	0.565	Kinesin light chain 1
13	9606.ENSP00000375810	0.556	Kinesin light chain 3
14	9606.ENSP00000425864	0.549	BLOC-1-related complex subunit 8
15	9606.ENSP00000265062	0.529	Ras-related protein Rab-7a
16	9606.ENSP00000381167	0.504	Cytoplasmic dynein 2 heavy chain 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019894	1.000	kinesin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051179	0.988	localization
GO:0071840	0.988	cellular component organization or biogenesis
GO:0050789	0.975	regulation of biological process
GO:0006996	0.972	organelle organization
GO:0050794	0.962	regulation of cellular process
GO:0050896	0.957	response to stimulus
GO:0051640	0.911	organelle localization
GO:0032418	0.881	lysosome localization
GO:0032879	0.590	regulation of localization
GO:0010256	0.579	endomembrane system organization
GO:0044419	0.545	biological process involved in interspecies interaction between organisms
GO:0006950	0.511	response to stress
GO:0060341	0.451	regulation of cellular localization
GO:0051707	0.445	response to other organism
GO:0098542	0.444	defense response to other organism
GO:0001906	0.426	cell killing
GO:0002449	0.426	lymphocyte mediated immunity
GO:0007030	0.426	Golgi organization
GO:0032880	0.418	regulation of protein localization
GO:0001909	0.413	leukocyte mediated cytotoxicity
GO:0045087	0.411	innate immune response
GO:0048518	0.341	positive regulation of biological process
GO:0051234	0.331	establishment of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030659	0.998	cytoplasmic vesicle membrane
GO:0005768	0.997	endosome
GO:0005765	0.997	lysosomal membrane
GO:0010008	0.992	endosome membrane
GO:0032991	0.611	protein-containing complex
GO:0005829	0.552	cytosol
GO:0005886	0.499	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]