StarFunc result for job id Q8IWG1

User Input

>input (891 residues)
MAPKQKKKTSRGKKRLKPVLAASEDMEPVNMESMGHPEIYPLVLTTKTQEIFNCRIDEDV
TDEQPYKLINKEDIFEDLRNRAAVSDFHPVKKIVQEYPGNELLLVYDKDFKYGLNFYLIA
TEEGKENYLNPPEVPEEQEEYKEHIPEDVYIYKPPVSKPWVSLGSEKEIEEESVTESTKQ
ITYMISRKRSEFGAPIKFSDQNASSVKDAYIECTAYPDKNFTLKQLEKDVGMQVIPQIKD
ISTQTKWTYPKNATTQYYPREFSEEEKETLKQSKPLVDFLNNASISVEIALQQNEIMNTF
IDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEKMITCVSWHPTIYGLIAVSVAVRL
SFEDRVHFSGKLLLQPSLILFWSFSDPIHPQLMLESPDDIFCFKFCPSDPNIIAGGCING
QIVMWDITAHADRIENIKAGGSRSKRATLKPMFLLEPESNKEAMYIRHCAVSSIENGHKK
VITDIHWLSDTFEINRMGSVFENRSGICCQLVTCSADCTICFWDIRPQKPLTPQTTEKKK
EESIEIPFDVPSTFLHLDLSWKPLTKVRLSKGETSLDHCPTKISLNEDHLLCKTQDKMLA
QSKTEKAEEMNPYHNLESGMANLLKPIDDFCTKFFVGTEEGEVIYTDWKMEKDPETGRLM
SKKPVSHHTIHDGTVHTIQRSPFYNDIILTVGGWNVAIWKEGVMTGPLLQSCCAPKRYTS
GHWSLTRPGVFYIGREDGYIDIWDLLEKTHEPAQSQNICITMITYIKPWIFSSKQQFIAT
ADYYGTLHILEIPWTLSRPSTNEMASVNHYFEREVKHLEYVEQRKKIREQEKKEMELEMA
KKKVKTYQKSKEQMQAELKMDYESYLELEKTVLINLGLIKVTEKGSYMEVM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IWG1	1.000	1.000	0.000	891	1.000	1.000	Q8IWG1.pdb.gz	DNAI3_HUMAN Dynein axonemal intermediate chain 3 OS=Homo sapiens OX=9606 GN=DNAI3 PE=1 SV=1
2	AFDB:A0A0G2KIZ8	0.586	0.543	2.978E-92	968	0.435	0.401	A0A0G2KIZ8.pdb.gz	DNAI3_DANRE Dynein axonemal intermediate chain 3 OS=Danio rerio OX=7955 GN=dnai3 PE=2 SV=3
3	AFDB:Q9VS90	0.436	0.349	6.261E-45	1132	0.199	0.156	Q9VS90.pdb.gz	Q9VS90_DROME Missing minor mitochondria OS=Drosophila melanogaster OX=7227 GN=mmm PE=4 SV=1
4	AFDB:M9PC80	0.406	0.605	1.933E-34	585	0.134	0.203	M9PC80.pdb.gz	M9PC80_DROME Dynein, axonemal, intermediate chain 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Dnai2 PE=4 SV=1
5	AFDB:A7MD87	0.370	0.635	7.786E-27	501	0.110	0.196	A7MD87.pdb.gz	A7MD87_DANRE WD repeat domain 34 OS=Danio rerio OX=7955 GN=dync2i1 PE=1 SV=1
6	AFDB:O88487	0.365	0.523	6.269E-26	612	0.128	0.186	O88487.pdb.gz	DC1I2_MOUSE Cytoplasmic dynein 1 intermediate chain 2 OS=Mus musculus OX=10090 GN=Dync1i2 PE=1 SV=1
7	AFDB:O14576	0.355	0.479	4.282E-25	645	0.136	0.188	O14576.pdb.gz	DC1I1_HUMAN Cytoplasmic dynein 1 intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1I1 PE=1 SV=2
8	AFDB:O45087	0.364	0.496	4.065E-24	643	0.117	0.162	O45087.pdb.gz	O45087_CAEEL WD_REPEATS_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dyci-1 PE=1 SV=1
9	PDB:7kzmE	0.380	0.678	7.852E-21	474	0.125	0.234	7kzmE.pdb.gz	Structure of a microtubule-bound axonemal dynein.
10	PDB:7kzmD	0.360	0.676	4.819E-19	456	0.098	0.191	7kzmD.pdb.gz	Structure of a microtubule-bound axonemal dynein.
11	PDB:6rlbC	0.336	0.573	4.834E-18	494	0.101	0.182	6rlbC.pdb.gz
12	PDB:6rlbD	0.352	0.667	1.298E-17	446	0.091	0.182	6rlbD.pdb.gz
13	PDB:6f1tp	0.305	0.637	9.368E-17	401	0.101	0.224	6f1tp.pdb.gz	Cryo-EM shows how dynactin recruits two dyneins for faster movement.
14	PDB:2ybaB	0.295	0.643	1.816E-15	382	0.072	0.168	2ybaB.pdb.gz	Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks
15	PDB:3cfvB	0.300	0.642	2.976E-15	393	0.071	0.160	3cfvB.pdb.gz	Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
16	PDB:3gfcA	0.308	0.747	3.915E-15	339	0.068	0.180	3gfcA.pdb.gz
17	AFDB:Q09649	0.301	0.376	4.659E-15	702	0.103	0.131	Q09649.pdb.gz	Q09649_CAEEL Anaphase-promoting complex subunit 4 WD40 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fzr-1 PE=1 SV=1
18	PDB:6s29C	0.312	0.664	1.632E-14	394	0.077	0.175	6s29C.pdb.gz
19	PDB:7bt6x	0.285	0.486	2.984E-14	488	0.073	0.133	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
20	AFDB:Q38BV9	0.297	0.336	1.750E-12	780	0.055	0.063	Q38BV9.pdb.gz	Q38BV9_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4780 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KIZ8	0.0	689	968	0.392	0.361	DNAI3_DANRE Dynein axonemal intermediate chain 3 OS=Danio rerio OX=7955 GN=dnai3 PE=2 SV=3
2	B2RY71	0.0	1469	923	0.811	0.783	DNAI3_MOUSE Dynein axonemal intermediate chain 3 OS=Mus musculus OX=10090 GN=Dnai3 PE=1 SV=1
3	Q8IWG1	0.0	1854	891	1.000	1.000	DNAI3_HUMAN Dynein axonemal intermediate chain 3 OS=Homo sapiens OX=9606 GN=DNAI3 PE=1 SV=1
4	A8J3B6	1.17e-100	338	1024	0.287	0.250	A8J3B6_CHLRE Uncharacterized protein OS=Chlamydomonas reinhardtii OX=3055 GN=CHLRE_16g674515v5 PE=1 SV=1
5	Q386T2	1.11e-44	176	809	0.198	0.218	Q386T2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.18.0003 PE=4 SV=1
6	Q9VS90	3.04e-43	172	1132	0.223	0.176	Q9VS90_DROME Missing minor mitochondria OS=Drosophila melanogaster OX=7227 GN=mmm PE=4 SV=1
7	A2AC93	1.99e-24	111	623	0.083	0.119	DNAI2_MOUSE Dynein axonemal intermediate chain 2 OS=Mus musculus OX=10090 GN=Dnai2 PE=1 SV=2
8	Q9GZS0	2.56e-24	110	605	0.084	0.124	DNAI2_HUMAN Dynein axonemal intermediate chain 2 OS=Homo sapiens OX=9606 GN=DNAI2 PE=1 SV=2
9	Q4QR00	1.64e-20	99.0	587	0.076	0.116	DNAI2_XENLA Dynein axonemal intermediate chain 2 OS=Xenopus laevis OX=8355 GN=dnai2 PE=1 SV=1
10	P27766	4.58e-20	97.4	567	0.077	0.122	DYI3_CHLRE Dynein, 70 kDa intermediate chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 GN=ODA6 PE=1 SV=1
11	M9PC80	4.53e-17	88.2	585	0.062	0.094	M9PC80_DROME Dynein, axonemal, intermediate chain 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Dnai2 PE=4 SV=1
12	Q9VTM3	4.94e-17	87.8	576	0.062	0.095	Q9VTM3_DROME Dynein, axonemal, intermediate chain 2, isoform B OS=Drosophila melanogaster OX=7227 GN=Dnai2 PE=4 SV=2
13	E7F6H7	5.35e-08	58.9	626	0.053	0.075	DCI2A_DANRE Dynein, cytoplasmic 1, intermediate chain 2a OS=Danio rerio OX=7955 GN=dync1i2a PE=3 SV=2
14	O88485	1.16e-07	58.2	628	0.053	0.075	DC1I1_MOUSE Cytoplasmic dynein 1 intermediate chain 1 OS=Mus musculus OX=10090 GN=Dync1i1 PE=1 SV=2
15	Q63100	1.31e-07	57.8	643	0.053	0.073	DC1I1_RAT Cytoplasmic dynein 1 intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dync1i1 PE=1 SV=1
16	Q29RQ3	3.95e-07	56.2	608	0.052	0.076	DC1I1_BOVIN Cytoplasmic dynein 1 intermediate chain 1 OS=Bos taurus OX=9913 GN=DYNC1I1 PE=1 SV=1
17	O14576	4.41e-07	56.2	645	0.052	0.071	DC1I1_HUMAN Cytoplasmic dynein 1 intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1I1 PE=1 SV=2
18	F1SF88	5.45e-07	55.8	622	0.052	0.074	F1SF88_PIG Dynein cytoplasmic 1 intermediate chain 1 OS=Sus scrofa OX=9823 GN=DYNC1I1 PE=1 SV=5
19	Q5BDC6	1.03e-06	55.1	689	0.083	0.107	Q5BDC6_EMENI Cytoplasmic dynein intermediate chain OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nudI PE=4 SV=1
20	Q13409	1.20e-06	54.7	638	0.051	0.071	DC1I2_HUMAN Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00400 WD40	2.4	20.4	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294664

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000458355	0.916	Dynein heavy chain 2, axonemal
2	9606.ENSP00000360065	0.908	WD repeat-containing protein 78
3	9606.ENSP00000480538	0.894	Dynein intermediate chain 1, axonemal
4	9606.ENSP00000318429	0.831	Coiled-coil domain-containing protein 114
5	9606.ENSP00000350954	0.797	WD repeat-containing protein 37
6	9606.ENSP00000383599	0.764	WD repeat-containing protein 47
7	9606.ENSP00000386770	0.748	Dynein heavy chain 10, axonemal
8	9606.ENSP00000265104	0.715	Dynein heavy chain 5, axonemal
9	9606.ENSP00000406012	0.709	Intraflagellar transport protein 140 homolog
10	9606.ENSP00000333363	0.702	Dynein heavy chain 8, axonemal
11	9606.ENSP00000199447	0.701	Thioredoxin domain-containing protein 3
12	9606.ENSP00000400252	0.699	Dynein intermediate chain 2, axonemal
13	9606.ENSP00000315680	0.695	Peroxisomal targeting signal 2 receptor
14	9606.ENSP00000379310	0.693	Protein phosphatase 1 regulatory subunits
15	9606.ENSP00000312399	0.692	Coiled-coil domain-containing protein 63
16	9606.ENSP00000261383	0.675	Dynein heavy chain 3, axonemal
17	9606.ENSP00000307491	0.675	WD repeat-containing protein 48
18	9606.ENSP00000374490	0.675	Dynein heavy chain 17, axonemal
19	9606.ENSP00000311273	0.673	Dynein heavy chain 7, axonemal
20	9606.ENSP00000401514	0.671	Dynein heavy chain 1, axonemal

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0071933	0.817	Arp2/3 complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.911	regulation of cellular process
GO:0040012	0.826	regulation of locomotion
GO:0009987	0.804	cellular process
GO:0048523	0.780	negative regulation of cellular process
GO:0051128	0.768	regulation of cellular component organization
GO:1902903	0.761	regulation of supramolecular fiber organization
GO:0051493	0.713	regulation of cytoskeleton organization
GO:0010639	0.697	negative regulation of organelle organization
GO:0032970	0.669	regulation of actin filament-based process
GO:0051125	0.659	regulation of actin nucleation
GO:0051494	0.648	negative regulation of cytoskeleton organization
GO:0040013	0.612	negative regulation of locomotion
GO:2000146	0.575	negative regulation of cell motility
GO:0030334	0.528	regulation of cell migration
GO:0071840	0.454	cellular component organization or biogenesis
GO:0016043	0.430	cellular component organization
GO:0030336	0.419	negative regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043227	0.997	membrane-bounded organelle
GO:0043229	0.997	intracellular organelle
GO:0032991	0.992	protein-containing complex
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0005929	0.978	cilium
GO:0015630	0.965	microtubule cytoskeleton
GO:1902494	0.952	catalytic complex
GO:0099568	0.945	cytoplasmic region
GO:0032838	0.942	plasma membrane bounded cell projection cytoplasm
GO:0097014	0.916	ciliary plasm
GO:0005930	0.873	axoneme
GO:0005875	0.866	microtubule associated complex
GO:0030286	0.815	dynein complex
GO:0005858	0.670	axonemal dynein complex
GO:0097729	0.421	9+2 motile cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]